LXL04_000120 | RubberDandelionOmics

Gene overview

LXL04_000120

Reference: OH-1004 Chr: Chr01 Coordinates: 2764796-2765484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · LXL04_000120|LXL04_000120|OH1004|cDNA

ATGTTTCTAGCCATGACCGAGGAGGTCCGGGTGATAATTGTCAAATTAGCAGACAAATTACATAACATGCGGACTCTTTCACATATGCCTTCACATAAGATGTCCAGCATTGCAATGGAGACACTACAGGTGTTTGCTCCTCTTGCAAAACTCCTTGGAATGTACCAAATTAAGTCTGAGCTTGAGAACTTGTCCTTCATGTACACAAATCCTCAAGACTATGCTAAAGTGAAGAGACAAGTTGCAGAGCTTTGTAAAGA...

CDS

Download CDS FASTA

381 bp · LXL04_000120|LXL04_000120|OH1004|CDS

ATGTTTCTAGCCATGACCGAGGAGGTCCGGGTGATAATTGTCAAATTAGCAGACAAATTACATAACATGCGGACTCTTTCACATATGCCTTCACATAAGATGTCCAGCATTGCAATGGAGACACTACAGGTGTTTGCTCCTCTTGCAAAACTCCTTGGAATGTACCAAATTAAGTCTGAGCTTGAGAACTTGTCCTTCATGTACACAAATCCTCAAGACTATGCTAAAGTGAAGAGACAAGTTGCAGAGCTTTGTAAAGA...

Protein

Download Protein FASTA

126 aa · LXL04_000120|LXL04_000120|OH1004|PROTEIN

MFLAMTEEVRVIIVKLADKLHNMRTLSHMPSHKMSSIAMETLQVFAPLAKLLGMYQIKSELENLSFMYTNPQDYAKVKRQVAELCKEQEKEIEEANKILIKTIEDDQFLDLMTVNTEVRSVCKINL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000120`
TK1151 ID	TkA01G632710
OH-1004 ID	LXL04_000120
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 80.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000120

Location Chr01:2764796-2765484 (-)

Description Similar to RSH1: Putative GTP diphosphokinase RSH1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0DKG8`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses.	No verified direct reference in this release
`At4g02260`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses (By similarity).	Expression profiling of four RelA/SpoT-like proteins, homologues of bacterial stringent factors, in Arabidopsis thaliana.2008 · DOI: 10.1007/s00425-008-0758-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0340900`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000120 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015949 nucleobase-containing small molecule interconversion Biological Process

GO:0015969 guanosine tetraphosphate metabolic process Biological Process

GO:0015970 guanosine tetraphosphate biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0042594 response to starvation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008728 GTP diphosphokinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G02260

bsu:BSU27600

dosa:Os03g0340900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.635

Rank 1 · LXL04_000120 · OH-1004

Nucleus0.304

Rank 2 · LXL04_000120 · OH-1004

Mitochondrion0.124

Rank 3 · LXL04_000120 · OH-1004

Cell membrane0.063

Rank 4 · LXL04_000120 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_000120 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13328.13HD_41-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000120	`PF13328.13`	HD_4	1	54	1.6e-15	57.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKG8`	Arabidopsis thaliana	Putative GTP diphosphokinase RSH1, chloroplastic	78.049%	Swiss-Prot	strong database homology
`F4JHA2`	Arabidopsis thaliana	Putative GTP diphosphokinase RSH1, chloroplastic	78.049%	Swiss-Prot	strong database homology
`Q9AYT5`	Oryza sativa subsp. japonica	Putative GTP diphosphokinase RSH1, chloroplastic	73.984%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card