LXL04_000024 | RubberDandelionOmics

Gene overview

LXL04_000024

Reference: OH-1004 Chr: Chr01 Coordinates: 538177-541113 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · LXL04_000024|LXL04_000024|OH1004|cDNA

ATGGGTTCCAGGGAGACGGAGCCATGGTTGCTCGAAAACGGAACTGTCAGGCGGCTAACAAGGGAGTCCAGAAACGGTCATGGACATAGCCGGACTGCTCACAACCTGTCGTCCACCTCCCTTCGTAAAAAGTCCGATATCTCCGTCATCTCTAGAGTTCCTTTCCCATTTCTTAGGAATTTCCTTGGCAACCTCCAGGAGGTGATTTTGGGAACTAAGTTATCAATTATTTTTCTGGCCGTCCCAATCGCCGTCGCCGC...

CDS

Download CDS FASTA

1326 bp · LXL04_000024|LXL04_000024|OH1004|CDS

ATGGGTTCCAGGGAGACGGAGCCATGGTTGCTCGAAAACGGAACTGTCAGGCGGCTAACAAGGGAGTCCAGAAACGGTCATGGACATAGCCGGACTGCTCACAACCTGTCGTCCACCTCCCTTCGTAAAAAGTCCGATATCTCCGTCATCTCTAGAGTTCCTTTCCCATTTCTTAGGAATTTCCTTGGCAACCTCCAGGAGGTGATTTTGGGAACTAAGTTATCAATTATTTTTCTGGCCGTCCCAATCGCCGTCGCCGC...

Protein

Download Protein FASTA

441 aa · LXL04_000024|LXL04_000024|OH1004|PROTEIN

MGSRETEPWLLENGTVRRLTRESRNGHGHSRTAHNLSSTSLRKKSDISVISRVPFPFLRNFLGNLQEVILGTKLSIIFLAVPIAVAAHYFRLPRAWIFLLSLLGLIPLAERVSFLTEQISFYTGATVGGLLNATCGNATELIIAIFALIQQKVDIVKYSLLGSILSNLLLVLGSSLLFGGIANLSRDQKFDRKQSDVNISLLLLSLLCNIIPLLYKHYGVARADVITGTLNVSRAACIIMLLAYFAYLAFQLWTHSHIFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000024`
TK1151 ID	TkA01G640740
OH-1004 ID	LXL04_000024
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.805 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000024

Location Chr01:538177-541113 (-)

Description Similar to CAX3: Vacuolar cation/proton exchanger 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51860`	Vacuolar cation/proton exchanger (CAX).	Functional association of Arabidopsis CAX1 and CAX3 is required for normal growth and ion homeostasis.2005 · DOI: 10.1104/pp.105.061218
`At2g38170`	Vacuolar cation/proton exchanger (CAX).	The Arabidopsis cax1 mutant exhibits impaired ion homeostasis, development, and hormonal responses and reveals interplay among vacuolar transporters.2003 · DOI: 10.1105/tpc.007385 Mutations in the Ca2+/H+ transporter CAX1 increase CBF/DREB1 expression and the cold-acclimation response in Arabidopsis.2003 · DOI: 10.1105/tpc.015248 Functional association of Arabidopsis CAX1 and CAX3 is required for normal growth and ion homeostasis.2005 · DOI: 10.1104/pp.105.061218
`At5g01490`	Vacuolar cation/proton exchanger (CAX).	Enhanced Cd2+ -selective root-tonoplast-transport in tobaccos expressing Arabidopsis cation exchangers.2007 · DOI: 10.1007/s00425-006-0352-7

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0557500`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173
`Os05g0594200`	Vacuolar cation/proton exchanger (CAX).	Expression profile of the genes for rice cation/H+ exchanger family and functional analysis in yeast.2005 · DOI: 10.1093/pcp/pci173

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000024 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006793 phosphorus metabolic process Biological Process

GO:0006812 monoatomic cation transport Biological Process

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0009624 response to nematode Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010351 lithium ion transport Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT2G38170

ath:AT3G51860

ath:AT5G01490

dosa:Os01g0557500

dosa:Os05g0594200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.433

Rank 1 · LXL04_000024 · OH-1004

Cell membrane0.269

Rank 2 · LXL04_000024 · OH-1004

Cytoplasm0.202

Rank 3 · LXL04_000024 · OH-1004

Golgi apparatus0.121

Rank 4 · LXL04_000024 · OH-1004

Endoplasmic reticulum0.108

Rank 5 · LXL04_000024 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex95-253 aa

PF01699.30Na_Ca_ex278-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000024	`PF01699.30`	Na_Ca_ex	95	253	7.6e-43	146.8
LXL04_000024	`PF01699.30`	Na_Ca_ex	278	417	7.6e-43	146.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z81`	Arabidopsis thaliana	Vacuolar cation/proton exchanger 3	63.697%	Swiss-Prot	strong database homology
`Q39253`	Arabidopsis thaliana	Vacuolar cation/proton exchanger 1	63.063%	Swiss-Prot	strong database homology
`Q945S5`	Arabidopsis thaliana	Vacuolar cation/proton exchanger 4	55.300%	Swiss-Prot	strong database homology
`Q769E5`	Oryza sativa subsp. japonica	Vacuolar cation/proton exchanger 1a	63.084%	Swiss-Prot	strong database homology
`Q5TKG3`	Oryza sativa subsp. japonica	Vacuolar cation/proton exchanger 1b	59.512%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card