TkA08G230940 | RubberDandelionOmics

Gene overview

TkA08G230940

Reference: TK1151 Chr: Chr08 Coordinates: 60160661-60169417 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2947 bp · TkA08G230940|TK1151|cDNA

CTTCAATCAAATTATCGAAAAGGGAATTAGTATCTTTTGATATTTTTTCCACATTCGATTTCATCTCACTCTCATTTTCCATACCAAGTTATGCGCAAGTTTTCATATTTCTTCTACAAAATGAAATTCTTAATGTTCTTGAAGATGCTACTTGTTGCTATTGTGGTTCTGTTTTCTGATAGTGTTGTTGGTAGGGAATGCAACAACGTTCCAACCGAGCTCTCATCGCATACCTTTCGTTACAAACTATTGAATTCTGA...

CDS

Download CDS FASTA

2583 bp · TkA08G230940|TK1151|CDS

ATGCGCAAGTTTTCATATTTCTTCTACAAAATGAAATTCTTAATGTTCTTGAAGATGCTACTTGTTGCTATTGTGGTTCTGTTTTCTGATAGTGTTGTTGGTAGGGAATGCAACAACGTTCCAACCGAGCTCTCATCGCATACCTTTCGTTACAAACTATTGAATTCTGATAACATGACTTGGAAGGAGGAGATGTTGTCTCATAGCCATAGCCATTTGACTCCAACTGATGATCATGCTTGGGCAAATCTGCTTCCTAG...

Protein

Download Protein FASTA

860 aa · TkA08G230940|TK1151|PROTEIN

MRKFSYFFYKMKFLMFLKMLLVAIVVLFSDSVVGRECNNVPTELSSHTFRYKLLNSDNMTWKEEMLSHSHSHLTPTDDHAWANLLPRKQLKHKEELAWMMMYKEMKKQVSGNFLKEVPMGDVRLDPNSVHGQAQQTNLEYLMMLEVDSLVWNFRKTAGLKTLGVPYGGWESPDSELRGHFVGHYLSATAQMWASTGNEALKNKMTAVVSALGECQEKLSTGYLSAFPSEFFDRFEAVQPVWAPYYTIHKIMAGLVDQYVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G230940`
TK1151 ID	TkA08G230940
OH-1004 ID	LXL04_033104
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.200
Protein coverage (%)	TK1151 98.023 / OH-1004 81.298 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G230940`
Location	Chr08:60160661-60169417 (+)
Description	Similar to hypBA1: Non-reducing end beta-L-arabinofuranosidase (Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033104` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.339

Rank 1 · TkA08G230940 · TK1151

Golgi apparatus0.216

Rank 2 · TkA08G230940 · TK1151

Cell membrane0.159

Rank 3 · TkA08G230940 · TK1151

Endoplasmic reticulum0.145

Rank 4 · TkA08G230940 · TK1151

Cytoplasm0.124

Rank 5 · TkA08G230940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07944Beta-AFase-like_GH127_cat121-503 aa

PF20736Glyco_hydro127M516-614 aa

PF16375DUF4986627-651 aa

PF16375DUF4986833-857 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G230940	`PF07944`	Beta-AFase-like_GH127_cat	121	503	8.4e-120	400.9
TkA08G230940	`PF20736`	Glyco_hydro127M	516	614	1.6e-13	51.3
TkA08G230940	`PF16375`	DUF4986	627	651	0.081	14.0
TkA08G230940	`PF16375`	DUF4986	833	857	0.081	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card