TkA08G076420 | RubberDandelionOmics

Gene overview

TkA08G076420

Reference: TK1151 Chr: Chr08 Coordinates: 19625121-19625525 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA08G076420|TK1151|cDNA

ATGGAAACCTCACAGTATGGTGGAGGACTATCCGAGTACGCTGTAAGTAGCGAAAAGTTAACCGTCAGTAGACCACCAGAGGTATCGGCGGCAGAAGGTGCCGGACTACCAGTCGCCGGACTCACCGCCCTCCAAGCCCTAACCTACCACGGCGGCATCACCCTCGACAAAACCACCCCCACACCCACCACCAACGTCCTCATCACCGCCGCCTCCGGCGGCGTCGGCCAGTACGCGGTAATCCAGCTCGCAAAGCTCGG...

CDS

Download CDS FASTA

405 bp · TkA08G076420|TK1151|CDS

ATGGAAACCTCACAGTATGGTGGAGGACTATCCGAGTACGCTGTAAGTAGCGAAAAGTTAACCGTCAGTAGACCACCAGAGGTATCGGCGGCAGAAGGTGCCGGACTACCAGTCGCCGGACTCACCGCCCTCCAAGCCCTAACCTACCACGGCGGCATCACCCTCGACAAAACCACCCCCACACCCACCACCAACGTCCTCATCACCGCCGCCTCCGGCGGCGTCGGCCAGTACGCGGTAATCCAGCTCGCAAAGCTCGG...

Protein

Download Protein FASTA

134 aa · TkA08G076420|TK1151|PROTEIN

METSQYGGGLSEYAVSSEKLTVSRPPEVSAAEGAGLPVAGLTALQALTYHGGITLDKTTPTPTTNVLITAASGGVGQYAVIQLAKLGNVHVHRELRARKYRPGKNLGVDRKRRLDYRTPEGAALKSTSDKNTTW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G076420`
TK1151 ID	TkA08G076420
OH-1004 ID	LXL04_000808
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 91.045 / OH-1004 14.303 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G076420

Location Chr08:19625121-19625525 (-)

Description Similar to CEQORH: Chloroplast envelope quinone oxidoreductase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13010`	NADPH-dependent alpha,beta-unsaturated oxoene reductase reducing the double bond of medium-chain (C9) to long-chain (C18) reactive electrophile species deriving from poly-unsaturated fatty acid peroxides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000808 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003960 quinone reductase (NADPH) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G13010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.857

Rank 1 · TkA08G076420 · TK1151

Mitochondrion0.041

Rank 2 · TkA08G076420 · TK1151

Cytoplasm0.035

Rank 3 · TkA08G076420 · TK1151

Plastid0.024

Rank 4 · TkA08G076420 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA08G076420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV68`	Arabidopsis thaliana	sp\|Q9SV68\|QORH_ARATH Chloroplast envelope quinone oxidoreductase homolog	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card