TkA07G280990 | RubberDandelionOmics

Gene overview

TkA07G280990

Reference: TK1151 Chr: Chr07 Coordinates: 70297711-70301051 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2481 bp · TkA07G280990|TK1151|cDNA

GCCGCTTTTATAAATATCCAATTCTTTAGTCAATTCTTAGTGACTACTTGGTAACTTGACAACGTTGGGTTCATTTCCTCCGGTTGTTCTCATCGTCTTCTTTCTCATAATCCACGTCCGCCACCGCCACCGCCACCGCCATCGCCACCGCCAAACGGTGGTTGTAGTTTAAGTTCCCTGCTCAACTCCACCAGGTAGCTTCTCCTTGATATTCTCCACTACACTTTCTTCTTCCTTCTTCCTCCCTCACCATCATCCTT...

CDS

Download CDS FASTA

1440 bp · TkA07G280990|TK1151|CDS

ATGGAGGACTTCTTGAAGGAGTTTCAACATCTCAAAATCCAACTGGAAGAGATAAAGTCAGCCACAAACAATTTTGATCTTAGCAACGTTATTGGAAAAGGTGGATTTGGGATGGTGTACAAAGGAGTACTCTCGCACTTTAAGGAACAAAACACGGTTGCTTTTAAGCGTCTAGATCGCAACTATGGGCAAGGAGACCCTGAATTTTGGAAAGAGATCCTGATGCTTTCCCAATACACACATAAAAATCTCATTTCTCT...

Protein

Download Protein FASTA

479 aa · TkA07G280990|TK1151|PROTEIN

MEDFLKEFQHLKIQLEEIKSATNNFDLSNVIGKGGFGMVYKGVLSHFKEQNTVAFKRLDRNYGQGDPEFWKEILMLSQYTHKNLISLLGFCDEDGEKILVYELASNGSLDRHLSSCTLTWRQRLKICVEAATGLCYLHDPNGTQHRVIHRDIKSSNILLDENWKAKISDMGLSKIGPANQQHSFLATNVAGTFGYVDPTYVEKSILTKESDVYSFGVVLFEVLCGRLCFVNNNGHFESLVGMWKKNYKRKELDAIIFEDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G280990`
TK1151 ID	TkA07G280990
OH-1004 ID	LXL04_029160
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.800
Protein coverage (%)	TK1151 89.770 / OH-1004 75.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G280990

Location Chr07:70297711-70301051 (-)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029160 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0090404 pollen tube tip Cellular Component

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G46290

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583

Rank 1 · TkA07G280990 · TK1151

Nucleus0.282

Rank 2 · TkA07G280990 · TK1151

Cell membrane0.233

Rank 3 · TkA07G280990 · TK1151

Golgi apparatus0.083

Rank 4 · TkA07G280990 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA07G280990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18570Nup54_57_C1-19 aa

PF07714PK_Tyr_Ser-Thr27-297 aa

PF00069Pkinase27-295 aa

PF30345E_spl_m6101-138 aa

PF01636APH138-164 aa

PF18570Nup54_57_C249-255 aa

PF05495zf-CHY349-422 aa

PF23461ZMYND11_CC370-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G280990	`PF18570`	Nup54_57_C	1	19	0.16	12.3
TkA07G280990	`PF07714`	PK_Tyr_Ser-Thr	27	297	1.1e-43	150.1
TkA07G280990	`PF00069`	Pkinase	27	295	3.1e-42	145.5
TkA07G280990	`PF30345`	E_spl_m6	101	138	0.15	13.3
TkA07G280990	`PF01636`	APH	138	164	0.39	11.2
TkA07G280990	`PF18570`	Nup54_57_C	249	255	0.16	12.3
TkA07G280990	`PF05495`	zf-CHY	349	422	5.4e-20	72.3
TkA07G280990	`PF23461`	ZMYND11_CC	370	386	0.063	14.4
TkA07G280990	`PF05495`	zf-CHY	422	463	5.4e-20	72.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	49.000%	Swiss-Prot	Medium
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	48.700%	Swiss-Prot	Medium
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	46.500%	Swiss-Prot	Medium
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	48.300%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	45.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card