TkA07G018950 | RubberDandelionOmics

Gene overview

TkA07G018950

Reference: TK1151 Chr: Chr07 Coordinates: 5104067-5111925 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

631 bp · TkA07G018950|TK1151|cDNA

AAGAAATCAAAGTAAGTTGAGAGTTAAGATCTTCAATGGCTTCCACTCCTGGACTTCTCACAGACTGGCCTTGGAAACCACTTGGAAACTTTAAGTACATGTTATTGGCACCGTGGGTGATGAAGAGTTATTATGAGTATGTCACGGCCGAAACGAAAGACATGATGTTGGCCTTCATTTTTCCGTTTCTTTTAACTAGAATGGTTGGTAATCAGATCTGGATTTCCCTTAATCGGTACATAACCGTAAAAGGTAAAAAC...

CDS

Download CDS FASTA

531 bp · TkA07G018950|TK1151|CDS

ATGGCTTCCACTCCTGGACTTCTCACAGACTGGCCTTGGAAACCACTTGGAAACTTTAAGTACATGTTATTGGCACCGTGGGTGATGAAGAGTTATTATGAGTATGTCACGGCCGAAACGAAAGACATGATGTTGGCCTTCATTTTTCCGTTTCTTTTAACTAGAATGGTTGGTAATCAGATCTGGATTTCCCTTAATCGGTACATAACCGTAAAAGGTAAAAACCGGATTGTCAACAAGACCATTGAATTCGAGCAAGT...

Protein

Download Protein FASTA

177 aa · TkA07G018950|TK1151|PROTEIN

MASTPGLLTDWPWKPLGNFKYMLLAPWVMKSYYEYVTAETKDMMLAFIFPFLLTRMVGNQIWISLNRYITVKGKNRIVNKTIEFEQVDRERDWDDQIILNGLLFYVGNYYIERAKFLPWWRSDGVIIVILLHAGVVEFLYYWLHRALHHHFLYNRYHYPHHSSIATEPITCNSLSLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G018950`
TK1151 ID	TkA07G018950
OH-1004 ID	LXL04_010627
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.100
Protein coverage (%)	TK1151 96.045 / OH-1004 26.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G018950

Location Chr07:5104067-5111925 (-)

Description Similar to GL1-5: Very-long-chain aldehyde decarbonylase GL1-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02205`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	Overexpression of Arabidopsis ECERIFERUM1 promotes wax very-long-chain alkane biosynthesis and influences plant response to biotic and abiotic stresses.2011 · DOI: 10.1104/pp.111.172320 Reconstitution of plant alkane biosynthesis in yeast demonstrates that Arabidopsis ECERIFERUM1 and ECERIFERUM3 are core components of a very-long-chain alkane synthesis complex.2012 · DOI: 10.1105/tpc.112.099796 Molecular characterization of the CER1 gene of arabidopsis involved in epicuticular wax biosynthesis and pollen fertility.1995 · DOI: 10.1105/tpc.7.12.2115
`At2g37700`	Protein CER1-like 2.	No verified direct reference in this release
`At1g02190`	Protein CER1-like 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BHF1`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`UniProt: A2XAY1`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010627 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008610 lipid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043447 alkane biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G02205

dosa:Os02g0621300

dosa:Os10g0471100

osa:4330012

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.869

Rank 1 · TkA07G018950 · TK1151

Nucleus0.085

Rank 2 · TkA07G018950 · TK1151

Golgi apparatus0.073

Rank 3 · TkA07G018950 · TK1151

Cytoplasm0.057

Rank 4 · TkA07G018950 · TK1151

Cell membrane0.034

Rank 5 · TkA07G018950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase45-57 aa

PF04116FA_hydroxylase130-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G018950	`PF04116`	FA_hydroxylase	45	57	5.9e-07	30.7
TkA07G018950	`PF04116`	FA_hydroxylase	130	172	5.9e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVY0`	Arabidopsis thaliana	sp\|F4HVY0\|CER1_ARATH Very-long-chain aldehyde decarbonylase CER1	62.200%	Swiss-Prot	High
`F4IR05`	Arabidopsis thaliana	sp\|F4IR05\|CERL2_ARATH Protein CER1-like 2	62.400%	Swiss-Prot	High
`F4HVX7`	Arabidopsis thaliana	sp\|F4HVX7\|CERL1_ARATH Protein CER1-like 1	63.400%	Swiss-Prot	High
`B8BHF1`	Oryza sativa subsp. indica	sp\|B8BHF1\|GLO15_ORYSI Very-long-chain aldehyde decarbonylase GL1-5	58.700%	Swiss-Prot	High
`A2XAY1`	Oryza sativa subsp. indica	sp\|A2XAY1\|GLO16_ORYSI Very-long-chain aldehyde decarbonylase GL1-6	54.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card