TkA07G007360 | RubberDandelionOmics

Gene overview

TkA07G007360

Reference: TK1151 Chr: Chr07 Coordinates: 2069223-2071850 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1807 bp · TkA07G007360|TK1151|cDNA

CTCTCTTTCTTCGTCGCACCCACCAGTCGCAAGAACACACAGAGACGCCGATCGAAGCTCCTATCTCCTCCTGCTGCCAGACGCCGATCCCACCTCCGGCACACATAGGTCAAATTAGCAAGTGATTGTACATGCTTCCTTCCCTCGATTCCAAAATGGATGTTATAACTTCATTAGAGGACTCTATTCCAGCAAGCATCCTTCAACCTTTCTTTTCTGCTACAAATTCATCTACACTAAACAAATCCTTAGAGAATCTA...

CDS

Download CDS FASTA

1494 bp · TkA07G007360|TK1151|CDS

ATGCTTCCTTCCCTCGATTCCAAAATGGATGTTATAACTTCATTAGAGGACTCTATTCCAGCAAGCATCCTTCAACCTTTCTTTTCTGCTACAAATTCATCTACACTAAACAAATCCTTAGAGAATCTAATAGAATCGGCTAAAACAACAGATGGTCGATCCAACCTTGCTTCCAAGAACATCCTCCCCACAGCCCTTCAACTCTGTAAATTACTATCTTACCCTTCTTCAAGTGACACACTTTTACTATCCCTTAAACT...

Protein

Download Protein FASTA

497 aa · TkA07G007360|TK1151|PROTEIN

MLPSLDSKMDVITSLEDSIPASILQPFFSATNSSTLNKSLENLIESAKTTDGRSNLASKNILPTALQLCKLLSYPSSSDTLLLSLKLIRNLCAGESRNQNSFIQENGVDVVSNMIISKDFISDSNYDIGIVIIRMGLQVLANVSLAGKEQQVVIWNCVCSLEFVEIAKVRRKDTCDPLCMIIYACIEENQELVDKLCSDHGLTLLVEIIQTASEVGFGEDWLKLILSRTCIEESYFTPIFSKLSNTPTNHTFPKEHTFTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G007360`
TK1151 ID	TkA07G007360
OH-1004 ID	LXL04_026784
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.390 / OH-1004 85.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G007360`
Location	Chr07:2069223-2071850 (+)
Description	Similar to atxn10: Ataxin-10
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026784` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0032465 regulation of cytokinesis Biological Process GO:0051301 cell division Biological Process GO:0060271 cilium assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005814 centriole Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005929 cilium Cellular Component GO:0030496 midbody Cellular Component GO:0036064 ciliary basal body Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0019899 enzyme binding Molecular Function
KEGG gene cross-reference	bta:767990 ddi:DDB_G0268880 mmu:54138 rno:170821 xtr:548542 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.613

Rank 1 · TkA07G007360 · TK1151

Nucleus0.582

Rank 2 · TkA07G007360 · TK1151

Mitochondrion0.056

Rank 3 · TkA07G007360 · TK1151

Cell membrane0.028

Rank 4 · TkA07G007360 · TK1151

Peroxisome0.027

Rank 5 · TkA07G007360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25579TPR_TRIP12_N23-116 aa

PF09759Atx10homo_assoc88-103 aa

PF09759Atx10homo_assoc186-207 aa

PF09759Atx10homo_assoc394-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G007360	`PF25579`	TPR_TRIP12_N	23	116	0.1	13.2
TkA07G007360	`PF09759`	Atx10homo_assoc	88	103	1e-31	109.5
TkA07G007360	`PF09759`	Atx10homo_assoc	186	207	1e-31	109.5
TkA07G007360	`PF09759`	Atx10homo_assoc	394	487	1e-31	109.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card