TkA07G005590 | RubberDandelionOmics

Gene overview

TkA07G005590

Reference: TK1151 Chr: Chr07 Coordinates: 1556378-1560961 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2434 bp · TkA07G005590|TK1151|cDNA

CTACAAAAGCTTTTGTTGCATCAAAACTCATAAAAAAAACCGGCATAAAAAGACTTCAATCGTCACCTCCGGTCACCGCCCCTCTCTCTCTCTCTAAGAAACTTCTGCTCTCTCTCTAAAAAACACACCACATGTGACAGTAACGATCAACAACACATCACCAACCTAAAATCACACGACCTCGTACGTGAATTCTTGTGTTTTGTTTCATGGTTCATCATCAATGGCGCCCAATAGAGTTCTATTGTATTTGATAAGTT...

CDS

Download CDS FASTA

1908 bp · TkA07G005590|TK1151|CDS

ATGGCGCCCAATAGAGTTCTATTGTATTTGATAAGTTTAAGGATGAAGAAAAGCAACATCTTCTTCATGGCGCTCACCACCGTCTTATGCTCTTGTTCTTACCTCTTCGGAAACTGGAAAACCGGAATCGCCACCACCACCATCGATTTCCGCCGTTCTCCTCCCTGCAACTTGAACATTAATCATCCAAACGCCACCTCTATTACCAGGACACAAACGCCACTCGATTTCATCCCCCACCACCTCCCTGATGACGACCT...

Protein

Download Protein FASTA

635 aa · TkA07G005590|TK1151|PROTEIN

MAPNRVLLYLISLRMKKSNIFFMALTTVLCSCSYLFGNWKTGIATTTIDFRRSPPCNLNINHPNATSITRTQTPLDFIPHHLPDDDLVTALPVARVKHIPPCIPKLSEYTPCEDVDRSLKFDRKRLVYRERHCPEKSEVLKCRIPAPYGYRQPFRWPGSRDAAWYANVPHKHLTVEKAGQNWVRFKGDRFSFPGGGTMFPNGAGAYIDDIGKLINLRDGSIRTAIDTGCGVASLGAYLLSRNILAMSFAPKDTHIAQVQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G005590`
TK1151 ID	TkA07G005590
OH-1004 ID	LXL04_026751
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G005590

Location Chr07:1556378-1560961 (-)

Description Similar to At4g00750: Probable methyltransferase PMT15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00750`	Probable methyltransferase PMT15.	No verified direct reference in this release
`At2g45750`	Probable methyltransferase PMT16.	No verified direct reference in this release
`At1g33170`	Probable methyltransferase PMT18.	No verified direct reference in this release
`At4g10440`	Probable methyltransferase PMT17.	No verified direct reference in this release
`At1g26850`	Probable methyltransferase PMT2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026751 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26850

ath:AT1G33170

ath:AT2G45750

ath:AT4G00750

ath:AT4G10440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.736

Rank 1 · TkA07G005590 · TK1151

Cell membrane0.077

Rank 2 · TkA07G005590 · TK1151

Endoplasmic reticulum0.070

Rank 3 · TkA07G005590 · TK1151

Extracellular0.070

Rank 4 · TkA07G005590 · TK1151

Cytoplasm0.038

Rank 5 · TkA07G005590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_29108-623 aa

PF13649Methyltransf_25225-316 aa

PF08241Methyltransf_11226-319 aa

PF13847Methyltransf_31278-324 aa

PF20922Anamorsin_N298-343 aa

PF13649Methyltransf_25536-578 aa

PF13847Methyltransf_31542-586 aa

PF17987PMT2_N542-596 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G005590	`PF03141`	Methyltransf_29	108	623	3.5e-219	729.3
TkA07G005590	`PF13649`	Methyltransf_25	225	316	5.4e-05	24.5
TkA07G005590	`PF08241`	Methyltransf_11	226	319	9.1e-08	33.4
TkA07G005590	`PF13847`	Methyltransf_31	278	324	0.0063	17.0
TkA07G005590	`PF20922`	Anamorsin_N	298	343	0.017	15.6
TkA07G005590	`PF13649`	Methyltransf_25	536	578	5.4e-05	24.5
TkA07G005590	`PF13847`	Methyltransf_31	542	586	0.0063	17.0
TkA07G005590	`PF17987`	PMT2_N	542	596	0.17	12.6
TkA07G005590	`PF08241`	Methyltransf_11	545	582	9.1e-08	33.4
TkA07G005590	`PF20922`	Anamorsin_N	563	588	0.017	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPH9`	Arabidopsis thaliana	sp\|Q9ZPH9\|PMTF_ARATH Probable methyltransferase PMT15	65.400%	Swiss-Prot	High
`O80844`	Arabidopsis thaliana	sp\|O80844\|PMTG_ARATH Probable methyltransferase PMT16	65.300%	Swiss-Prot	High
`Q9C884`	Arabidopsis thaliana	sp\|Q9C884\|PMTI_ARATH Probable methyltransferase PMT18	54.700%	Swiss-Prot	High
`Q9SZX8`	Arabidopsis thaliana	sp\|Q9SZX8\|PMTH_ARATH Probable methyltransferase PMT17	56.900%	Swiss-Prot	High
`B9DFI7`	Arabidopsis thaliana	sp\|B9DFI7\|PMT2_ARATH Probable methyltransferase PMT2	54.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card