TkA06G425410 | RubberDandelionOmics

Gene overview

TkA06G425410

Reference: TK1151 Chr: Chr06 Coordinates: 105208207-105212781 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1410 bp · TkA06G425410|TK1151|cDNA

GCCACGTCACCTTTCCGTACTATCCCTTTAAACTCGTTTCTCTCTTCTTTAATTCGTCTTTCTATCCTCTTTGTATATCTCCGGCACCGATCGGATTTGACCTCCGACGGTTCTTCCAAAATCGATCACGTATTACATTTATATGAATAATTGATCAACTGATCAAGTGATCAGATTATGGAGGATCAAAATTACTTCGTTAATCTGATGGATTTTATCAATAGACCGGCTTTGATTGAAACATTTGTCGACATTTTCTT...

CDS

Download CDS FASTA

1233 bp · TkA06G425410|TK1151|CDS

ATGGAGGATCAAAATTACTTCGTTAATCTGATGGATTTTATCAATAGACCGGCTTTGATTGAAACATTTGTCGACATTTTCTTTTGTGCGGTCCCGATTTGGGTGGCGGTGATGGTCGGGGTTGTGATCGGATGGGCTTGGACTCCACGGTGGACCAGCCTTGTGTTTTTAGGTTTCCGTTCCAAGTTGCGAGGGTTCGCTTGGACGGCTCCACCGGGTTTCGGTGCTCGCCGCCTTTGGCTTGCCTTCACTGCGCTATC...

Protein

Download Protein FASTA

411 aa · TkA06G425410|TK1151|PROTEIN

MEDQNYFVNLMDFINRPALIETFVDIFFCAVPIWVAVMVGVVIGWAWTPRWTSLVFLGFRSKLRGFAWTAPPGFGARRLWLAFTALSAFSVGRRLWSSFREKERKDDQLSPRAVVGGESSPTAQYVDGSGVDIKCSIVNSGGDHEVVTEKDLEHLIHLLDGKDLAWQSMIERSTSNMACQAWRYEPESGPVVYRSRTVFEEATPELVRDFFWDDEFRPKWDPMLTYFNILEECPHTGTMIVHWIKKFPFFCSDREYIIGR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G425410`
TK1151 ID	TkA06G425410
OH-1004 ID	LXL04_022944
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 91.741 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G425410`
Location	Chr06:105208207-105212781 (-)
Description	Similar to STARD7: StAR-related lipid transfer protein 7, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022944` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0006744 ubiquinone biosynthetic process Biological Process GO:0006869 lipid transport Biological Process GO:0007006 mitochondrial membrane organization Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0015914 phospholipid transport Biological Process GO:0042092 type 2 immune response Biological Process GO:0043457 regulation of cellular respiration Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:0120163 negative regulation of cold-induced thermogenesis Biological Process GO:0120197 mucociliary clearance Biological Process GO:0005576 extracellular region Cellular Component
KEGG gene cross-reference	hsa:56910 hsa:58488 mmu:99138 rno:29510 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.317

Rank 1 · TkA06G425410 · TK1151

Plastid0.316

Rank 2 · TkA06G425410 · TK1151

Endoplasmic reticulum0.154

Rank 3 · TkA06G425410 · TK1151

Cytoplasm0.110

Rank 4 · TkA06G425410 · TK1151

Nucleus0.095

Rank 5 · TkA06G425410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01852START154-317 aa

PF29728Aq_581244-275 aa

PF29728Aq_581317-338 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G425410	`PF01852`	START	154	317	3e-05	24.2
TkA06G425410	`PF29728`	Aq_581	244	275	0.25	12.0
TkA06G425410	`PF29728`	Aq_581	317	338	0.25	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card