TkA06G236400 | RubberDandelionOmics

Gene overview

TkA06G236400

Reference: TK1151 Chr: Chr06 Coordinates: 60634017-60636507 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1953 bp · TkA06G236400|TK1151|cDNA

AAAAGATTAAAAACACGTGAATTAATTTGTTGTTGATTTAATCTTAGTCAAAATCGGGCGCGTTGACGAAGGCAATAAATATACCACGTCAACAGTCCTTTTCGGGCAGAAAAAGCCCTATTTGTCGTTTCCTAAATCCTCCTAAGATTTTTATAACCCTTTTTCTTCAACCTTTATCGTTTTCATCACAAATTCAATCTTCAACATCAATACCCTAAAAGGCTAAAACCTTCAGAGATCAGATTATGTCTTGTGTCTGT...

CDS

Download CDS FASTA

987 bp · TkA06G236400|TK1151|CDS

ATGTCTTGTGTCTGTGATTTCTGTAATCAGAGATCGGCGGTGTTGTACTGTAAAGCCGATTCGGCTAAGCTCTGTTTGTTCTGTGATAACGCCGTCCACTCTGCTAATGCTTTATCTCTCAAACACTTCCGTTCTCAGATCTGTGACAACTGCGGATCTGATGCCGTTTCCGTCGCCTGTTCAACCGACAATCTTCTCCTCTGCACCTCCTGCGATCACGATTTTCATGGAGACTCCTCCGTTTCCTCTTACCACAATCG...

Protein

Download Protein FASTA

328 aa · TkA06G236400|TK1151|PROTEIN

MSCVCDFCNQRSAVLYCKADSAKLCLFCDNAVHSANALSLKHFRSQICDNCGSDAVSVACSTDNLLLCTSCDHDFHGDSSVSSYHNRVPVEEFSGCPSAFQLASIWGFNLKPSGSNGNSCESKYSTSNFHDLATIDEKNPCYDEVPSVDWKSRGSGCGVHNKVLYKQLVELAKEKFDGDGAEMGPQTPNGCGGREVSEGFEYEEQDEKDPLHQQTPLTYLLMPHQNPTNSKPKNGGIAEFNNMWSYSPKRETSQIWDFNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G236400`
TK1151 ID	TkA06G236400
OH-1004 ID	LXL04_023724
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 96.951 / OH-1004 75.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G236400

Location Chr06:60634017-60636507 (-)

Description Similar to COL15: Zinc finger protein CONSTANS-LIKE 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33500`	Zinc finger protein CONSTANS-LIKE 14.	No verified direct reference in this release
`At1g28050`	Zinc finger protein CONSTANS-LIKE 15.	No verified direct reference in this release
`At4g15250`	Putative zinc finger protein CONSTANS-LIKE 11.	No verified direct reference in this release
`At2g47890`	Zinc finger protein CONSTANS-LIKE 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023724 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009637 response to blue light Biological Process

GO:0010114 response to red light Biological Process

GO:0010218 response to far red light Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G28050

ath:AT2G33500

ath:AT2G47890

ath:AT5G48250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.622

Rank 1 · TkA06G236400 · TK1151

Cytoplasm0.371

Rank 2 · TkA06G236400 · TK1151

Cell membrane0.076

Rank 3 · TkA06G236400 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA06G236400 · TK1151

Golgi apparatus0.047

Rank 5 · TkA06G236400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00643zf-B_box4-42 aa

PF22586ANCHR-like_BBOX4-37 aa

PF11682Zn_ribbon_1123-34 aa

PF00643zf-B_box45-90 aa

PF22586ANCHR-like_BBOX48-84 aa

PF11682Zn_ribbon_1148-59 aa

PF11682Zn_ribbon_1168-77 aa

PF15524Ntox17226-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G236400	`PF00643`	zf-B_box	4	42	5.1e-10	40.1
TkA06G236400	`PF22586`	ANCHR-like_BBOX	4	37	0.0011	19.7
TkA06G236400	`PF11682`	Zn_ribbon_11	23	34	0.89	10.1
TkA06G236400	`PF00643`	zf-B_box	45	90	5.1e-10	40.1
TkA06G236400	`PF22586`	ANCHR-like_BBOX	48	84	0.0011	19.7
TkA06G236400	`PF11682`	Zn_ribbon_11	48	59	0.89	10.1
TkA06G236400	`PF11682`	Zn_ribbon_11	68	77	0.89	10.1
TkA06G236400	`PF15524`	Ntox17	226	279	0.054	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22800`	Arabidopsis thaliana	sp\|O22800\|COL14_ARATH Zinc finger protein CONSTANS-LIKE 14	43.900%	Swiss-Prot	Medium
`Q9C7E8`	Arabidopsis thaliana	sp\|Q9C7E8\|COL15_ARATH Zinc finger protein CONSTANS-LIKE 15	42.100%	Swiss-Prot	Medium
`O23379`	Arabidopsis thaliana	sp\|O23379\|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11	54.000%	Swiss-Prot	Low
`O82256`	Arabidopsis thaliana	sp\|O82256\|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card