TkA06G075120 | RubberDandelionOmics

Gene overview

TkA06G075120

Reference: TK1151 Chr: Chr06 Coordinates: 20136367-20139266 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2467 bp · TkA06G075120|TK1151|cDNA

AAACAACAACCCCTTAATAAATCGATTGGGATTATATTGAATAGTAATTCACAAAAAGAGAAGGACCCAAGAGTTGTGTAATTTTGGTGGTAATGCTGGCCACTTTTCATAAAGATGGGGGGTCTACTTGAAAATTACGCAATCTACCCCATTTTTCCATTTTCATCTCTCTTTCACAGGCTCTCACACACTCTCACTGCCTCTGGATTAGTATTTGTTTTTAGTTTGATTTTGATTTTGATTTTGTTGAACTGGTCATT...

CDS

Download CDS FASTA

1461 bp · TkA06G075120|TK1151|CDS

ATGAATACCGGTGATGAAAAAAGAGTGGAGTCTTGGCATGTTGTAAAATCTAAGGGGAAGAGCAATAAACCTAAAAAAAGAGATGCAATTTGTATGGAAACGGAGGAGGGGACTACCACCGGGTGTTGGAACAGGTGGAAGTTCATCGGCAGCTGTATTTCTTCAAGATCTAAAGTCGATAATTCAATCAGTGGCATCAGTACTACTCCCGGTGAAAGCAAATCGACAAATGACGTAAGCAAAGATCAACCGGTGGTTCC...

Protein

Download Protein FASTA

486 aa · TkA06G075120|TK1151|PROTEIN

MNTGDEKRVESWHVVKSKGKSNKPKKRDAICMETEEGTTTGCWNRWKFIGSCISSRSKVDNSISGISTTPGESKSTNDVSKDQPVVPAISSTTTSTGESVSSTQKLEDEIKIASRLRKFAFNDLKMATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLIHPNLVKLIGYCIEDDQRLLAYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAKRPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G075120`
TK1151 ID	TkA06G075120
OH-1004 ID	LXL04_025211
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G075120

Location Chr06:20136367-20139266 (+)

Description Similar to PIX7: Probable serine/threonine-protein kinase PIX7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15080`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g01300`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g28690`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At1g07570`	Possible bi-functional kinase.	Novel protein kinase of Arabidopsis thaliana (APK1) that phosphorylates tyrosine, serine and threonine.1992 · DOI: 10.1007/bf00046450

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0110900`	Functions downstream of CERK1 in the microbial peptidoglycans (PGNs) and fungal chitin signaling pathways that mediate innate immunity.	OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process

GO:0045087 innate immune response Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:2000280 regulation of root development Biological Process

KEGG gene cross-reference

ath:AT1G07570

ath:AT3G01300

ath:AT3G28690

ath:AT5G15080

dosa:Os05g0110900

osa:4337593

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.690

Rank 1 · TkA06G075120 · TK1151

Nucleus0.245

Rank 2 · TkA06G075120 · TK1151

Cytoplasm0.229

Rank 3 · TkA06G075120 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA06G075120 · TK1151

Golgi apparatus0.024

Rank 5 · TkA06G075120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase134-409 aa

PF07714PK_Tyr_Ser-Thr135-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G075120	`PF00069`	Pkinase	134	409	8.9e-45	153.8
TkA06G075120	`PF07714`	PK_Tyr_Ser-Thr	135	411	3.3e-45	155.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP7`	Arabidopsis thaliana	sp\|Q9LFP7\|PBL34_ARATH Serine/threonine-protein kinase PBL34	74.800%	Swiss-Prot	High
`Q9SRH7`	Arabidopsis thaliana	sp\|Q9SRH7\|PBL35_ARATH Serine/threonine-protein kinase PBL35	73.900%	Swiss-Prot	High
`F4J0D2`	Arabidopsis thaliana	sp\|F4J0D2\|PBL36_ARATH Serine/threonine-protein kinase PBL36	67.100%	Swiss-Prot	High
`Q06548`	Arabidopsis thaliana	sp\|Q06548\|PBL9_ARATH Probable serine/threonine-protein kinase PBL9	67.100%	Swiss-Prot	Medium
`Q65XV8`	Oryza sativa subsp. japonica	sp\|Q65XV8\|RK176_ORYSJ Receptor-like cytoplasmic kinase 176	67.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card