TkA06G071080 | RubberDandelionOmics

Gene overview

TkA06G071080

Reference: TK1151 Chr: Chr06 Coordinates: 19025672-19028922 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2108 bp · TkA06G071080|TK1151|cDNA

CAAATAAATAAAATATGTCACCTAATATTACAAAACAAAAATTATTTTCCACGATTTACGGTTACAACTCATTTTTGTTCAAAAGTAATCATCTTAACAAAAGCCCGATTTCTAACAAACCCTGCCGTCGTGATTTCCAATTTAGTACCTTTCTCCCCTCACGGCCTACGCGTGGTGGATGCAGCAGACCCCGCCGGAGCTCGTCGTCTCTCTCCACACCCGTTTCAGTCAATTCCTCTTCTGCAACCACTGCCCCAGAC...

CDS

Download CDS FASTA

1860 bp · TkA06G071080|TK1151|CDS

CAAATAAATAAAATATGTCACCTAATATTACAAAACAAAAATTATTTTCCACGATTTACGGTTACAACTCATTTTTGTTCAAAAGTAATCATCTTAACAAAAGCCCGATTTCTAACAAACCCTGCCGTCGTGATTTCCAATTTAGTACCTTTCTCCCCTCACGGCCTACGCGTGGTGGATGCAGCAGACCCCGCCGGAGCTCGTCGTCTCTCTCCACACCCGTTTCAGTCAATTCCTCTTCTGCAACCACTGCCCCAGAC...

Protein

Download Protein FASTA

619 aa · TkA06G071080|TK1151|PROTEIN

QINKICHLILQNKNYFPRFTVTTHFCSKVIILTKARFLTNPAVVISNLVPFSPHGLRVVDAADPAGARRLSPHPFQSIPLLQPLPQTADSTHILCMEIEEESGGSRNKRHKPVDLNWEQLLPSSSGDEDRPSELVVISKKKSKGGGSGGDTQEIQKEDLELQTRPDNEIIESIARIKKNLQKLSHKLPDKGEKLRANLQRHEDELERRNKLQSEKGDSGCDETIQLSDHSDEGDSSGKKKSDEKSSSSSKFTKLFKKKLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G071080`
TK1151 ID	TkA06G071080
OH-1004 ID	LXL04_001448
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.500
Protein coverage (%)	TK1151 37.157 / OH-1004 24.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G071080

Location Chr06:19025672-19028922 (-)

Description Similar to ULP2B: Probable ubiquitin-like-specific protease 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60220`	Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins.	SUMO-conjugating and SUMO-deconjugating enzymes from Arabidopsis.2006 · DOI: 10.1104/pp.106.085415 Small ubiquitin-like modifier proteases OVERLY TOLERANT TO SALT1 and -2 regulate salt stress responses in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058669
`At1g10570`	Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins.	SUMO-conjugating and SUMO-deconjugating enzymes from Arabidopsis.2006 · DOI: 10.1104/pp.106.085415 Small ubiquitin-like modifier proteases OVERLY TOLERANT TO SALT1 and -2 regulate salt stress responses in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058669
`At1g09730`	Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins.	No verified direct reference in this release
`At4g33620`	Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001448 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0016926 protein desumoylation Biological Process

GO:0048576 positive regulation of short-day photoperiodism, flowering Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0055046 microgametogenesis Biological Process

GO:2000765 regulation of cytoplasmic translation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G09730

ath:AT1G10570

ath:AT1G60220

ath:AT4G33620

spo:2542268

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.872

Rank 1 · TkA06G071080 · TK1151

Cytoplasm0.169

Rank 2 · TkA06G071080 · TK1151

Cell membrane0.040

Rank 3 · TkA06G071080 · TK1151

Mitochondrion0.026

Rank 4 · TkA06G071080 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA06G071080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02902Peptidase_C48400-592 aa

PF12655CDIF630_02480-like513-532 aa

PF12655CDIF630_02480-like534-552 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G071080	`PF02902`	Peptidase_C48	400	592	9.3e-34	117.9
TkA06G071080	`PF12655`	CDIF630_02480-like	513	532	0.11	13.2
TkA06G071080	`PF12655`	CDIF630_02480-like	534	552	0.11	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2PS26`	Arabidopsis thaliana	sp\|Q2PS26\|ULP1D_ARATH Ubiquitin-like-specific protease 1D	50.200%	Swiss-Prot	Low
`Q8RWN0`	Arabidopsis thaliana	sp\|Q8RWN0\|ULP1C_ARATH Ubiquitin-like-specific protease 1C	33.900%	Swiss-Prot	Medium
`Q8L7S0`	Arabidopsis thaliana	sp\|Q8L7S0\|ULP2B_ARATH Probable ubiquitin-like-specific protease 2B	34.700%	Swiss-Prot	Low
`Q0WKV8`	Arabidopsis thaliana	sp\|Q0WKV8\|ULP2A_ARATH Probable ubiquitin-like-specific protease 2A	32.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card