TkA06G070650 | RubberDandelionOmics

Gene overview

TkA06G070650

Reference: TK1151 Chr: Chr06 Coordinates: 18913377-18915158 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · TkA06G070650|TK1151|cDNA

AAGTGCGGTCCGATTCCAATGGTGGACAAAACCATGTCGTTTTTTTCTCTTTTCATGGCTTTCTAGAAACGATTGAGTTGCAGTCGCCATCAAAGTGGCATCCAATTCCCACGAATTTGGAGCAAATTAGTTCTCGGGTGACCTCAAGCCACCGTCTTTCACGTGTCTCTTTCTCATATGGGCCTTGCATTTGGCACTGCGAACGTGGATTTACTTCCATCAAGAGTATTCTCCCCTCTCTCTCCTCCCTTAAACCCTTC...

CDS

Download CDS FASTA

918 bp · TkA06G070650|TK1151|CDS

ATGAGTGATTTCAGAACGAAATTGGGGGTGGAAGGAGGCGGGTGTTACTATTATGGCATATGCACCGCCGGTGGAATGTTCAGCGCCGGCGCCACCCATCTCGCCGTCACCCCTCTTGATGTCTTGAAAGTCAATATGCAGGTGAATCCAATCAAGTTTCACAGTATAGCCTCTGGTTTGAATATTCTCTGGAAAGAAGAAGGCCCTTCATCTCTATGGAGAGGGTGGTCCGGTAAGCTATTCGGCTATGGCGTTCAAGG...

Protein

Download Protein FASTA

305 aa · TkA06G070650|TK1151|PROTEIN

MSDFRTKLGVEGGGCYYYGICTAGGMFSAGATHLAVTPLDVLKVNMQVNPIKFHSIASGLNILWKEEGPSSLWRGWSGKLFGYGVQGGFKFGLYEFFKKHYTDVLTNERQSIVYFLSSASAQVFADMALCPFEAVKVRVQTQPNFAKGLSDGFPKLYAREGISGFYKGLLPLWGRNLPFSMIMFSTFEHSVDLIYKKFVQKRKEECSMGQQLGVTCLAGYTAGAVGTVISNPADNIVSSLYNKKANTVLQAAKNIGMMNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G070650`
TK1151 ID	TkA06G070650
OH-1004 ID	LXL04_025273
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G070650

Location Chr06:18913377-18915158 (+)

Description Similar to MPT1: Mitochondrial phosphate carrier protein 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17270`	Transport of phosphate groups from the cytosol to the mitochondrial matrix.	No verified direct reference in this release
`At5g14040`	Transport of phosphate groups from the cytosol to the mitochondrial matrix.	No verified direct reference in this release
`At3g48850`	Transport of phosphate groups from the cytosol to the mitochondrial matrix.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025273 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0035435 phosphate ion transmembrane transport Biological Process

GO:1990547 mitochondrial phosphate ion transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0005315 phosphate transmembrane transporter activity Molecular Function

GO:0015317 phosphate:proton symporter activity Molecular Function

GO:0044877 protein-containing complex binding Molecular Function

KEGG gene cross-reference

ath:AT2G17270

ath:AT3G48850

ath:AT5G14040

mmu:18674

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.933

Rank 1 · TkA06G070650 · TK1151

Cytoplasm0.028

Rank 2 · TkA06G070650 · TK1151

Nucleus0.024

Rank 3 · TkA06G070650 · TK1151

Cell membrane0.023

Rank 4 · TkA06G070650 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA06G070650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr22-103 aa

PF00153Mito_carr110-197 aa

PF00153Mito_carr213-288 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G070650	`PF00153`	Mito_carr	22	103	1.3e-44	150.6
TkA06G070650	`PF00153`	Mito_carr	110	197	1.3e-44	150.6
TkA06G070650	`PF00153`	Mito_carr	213	288	1.3e-44	150.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7DNC3`	Arabidopsis thaliana	sp\|Q7DNC3\|MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial	68.900%	Swiss-Prot	High
`Q9FMU6`	Arabidopsis thaliana	sp\|Q9FMU6\|MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial	52.500%	Swiss-Prot	High
`Q9M2Z8`	Arabidopsis thaliana	sp\|Q9M2Z8\|MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial	52.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card