TkA06G069100 | RubberDandelionOmics

Gene overview

TkA06G069100

Reference: TK1151 Chr: Chr06 Coordinates: 18491638-18495678 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3520 bp · TkA06G069100|TK1151|cDNA

CGCACTTTCACTCTTAAAAGTACTTACACCCTCTCTCTCTCACACACAACACACTGACGATGCATTCTCTCTCTCTGTCCACTACTTCTACAAACCGACGAGATATTCCCCGCTGTCAAAGATTCCTCCACCGGCCCCCTTTTCCCCTTTCTCTTCGAATCCCTAAAATTTCAATTCCAATCTACCCCCTCTGAAAATCACTCATTTTCTGTCCTTTATTTCAATCCAATTGGGTAAAAAGATCGGATTTTTATCTATAT...

CDS

Download CDS FASTA

2649 bp · TkA06G069100|TK1151|CDS

ATGGGTTGTGTGGGTTCGAAGCCCGAGGAGTCGCCGGCGGTGGCGCTGTGTAGGCAGAGATGCACCTTCCTCGATGAAGCCATCCACCAACGGTATGCTCTTGCGGAAGCCCATTTAGCTTACTGTCACTCTCTCAAGAACGTCGGTGTTTCGCTCCATCGGTTCTTCGATATCCATTCATCCGCCGCCGTGCACGCCGCCGATAGTCCTCCGTCTCCGGTGCTTAACCTTCCTCCCCAAAGGAAGGGGGAGCCTTCCAA...

Protein

Download Protein FASTA

882 aa · TkA06G069100|TK1151|PROTEIN

MGCVGSKPEESPAVALCRQRCTFLDEAIHQRYALAEAHLAYCHSLKNVGVSLHRFFDIHSSAAVHAADSPPSPVLNLPPQRKGEPSKPPVPAAVHDQPHSNSGSGHLHFHSDSDEDSEDDDGSIHLHSVNDGSPLDQHRPYGNAPTYNDQHETASSSYPPPFYPPSGYPPAGFPPSGYPPAGYPPSGFLPSSFPPAGYPPSGYPPAGYPPPDYPPESYAPGRYTMNFMRKQPTPSVVYQQRPMSPETIHYGEASNSSSSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G069100`
TK1151 ID	TkA06G069100
OH-1004 ID	LXL04_025297
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.206 / OH-1004 98.315 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G069100

Location Chr06:18491638-18495678 (-)

Description Similar to APSR1: Protein ALTERED PHOSPHATE STARVATION RESPONSE 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51290`	Required for the coordination of cell differentiation and cell elongation in the root tip.	No verified direct reference in this release
`At3g60320`	Required for nitrate signaling.	The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.2016 · DOI: 10.1105/tpc.15.00567

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0562700`	Involved in the regulation of leaf shape formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025297 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0030154 cell differentiation Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0071705 nitrogen compound transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G51290

ath:AT3G60320

dosa:Os10g0562700

osa:4349394

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.542

Rank 1 · TkA06G069100 · TK1151

Cytoplasm0.284

Rank 2 · TkA06G069100 · TK1151

Nucleus0.255

Rank 3 · TkA06G069100 · TK1151

Endoplasmic reticulum0.062

Rank 4 · TkA06G069100 · TK1151

Plastid0.040

Rank 5 · TkA06G069100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04783DUF6301-57 aa

PF04782DUF632459-764 aa

PF22634POL2_thumb601-674 aa

PF04782DUF632775-803 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G069100	`PF04783`	DUF630	1	57	1.8e-25	89.6
TkA06G069100	`PF04782`	DUF632	459	764	6.6e-103	345.0
TkA06G069100	`PF22634`	POL2_thumb	601	674	0.11	13.2
TkA06G069100	`PF04782`	DUF632	775	803	6.6e-103	345.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A178VBJ0`	Arabidopsis thaliana	sp\|A0A178VBJ0\|APSR1_ARATH Protein ALTERED PHOSPHATE STARVATION RESPONSE 1	25.900%	Swiss-Prot	Low
`Q93YU8`	Arabidopsis thaliana	sp\|Q93YU8\|NRG2_ARATH Nitrate regulatory gene2 protein	31.400%	Swiss-Prot	Low
`Q9AQW1`	Oryza sativa subsp. japonica	sp\|Q9AQW1\|REL2_ORYSJ Protein ROLLING AND ERECT LEAF 2	26.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card