TkA06G061570 | RubberDandelionOmics

Gene overview

TkA06G061570

Reference: TK1151 Chr: Chr06 Coordinates: 16606140-16609414 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2180 bp · TkA06G061570|TK1151|cDNA

GGAAGTTTGATTGGGAAAGAAGCAAAAACGAGTTTGAATTGGTTGGTAAACTTTCTTACCGGGAGAAACACACCAACGTGCTGAAATCATGTCCAGATATTTCAATTTCCCCACCACGTCAATGTCTACCAATTCATCTTCTCCTCACTTCTTCAATTCCTCCACAGCAAACCAGATCAACAATACTCCATTCATGGATCCTAAAACCCTAATTCGCCACAACGCATACCTCAAAACAATCCCAGTAAGCCCTAAATTCA...

CDS

Download CDS FASTA

1797 bp · TkA06G061570|TK1151|CDS

ATGTCCAGATATTTCAATTTCCCCACCACGTCAATGTCTACCAATTCATCTTCTCCTCACTTCTTCAATTCCTCCACAGCAAACCAGATCAACAATACTCCATTCATGGATCCTAAAACCCTAATTCGCCACAACGCATACCTCAAAACAATCCCAGTAAGCCCTAAATTCAATTCATTACCCTCCTATTTGTCTCCTTCGCAATGCCGTTCGCGCATTCAATCTAGCCTTCGATCGTCCCATTATCCGTTGTTTGGAAA...

Protein

Download Protein FASTA

598 aa · TkA06G061570|TK1151|PROTEIN

MSRYFNFPTTSMSTNSSSPHFFNSSTANQINNTPFMDPKTLIRHNAYLKTIPVSPKFNSLPSYLSPSQCRSRIQSSLRSSHYPLFGKIRYRNQLFTHINPSRRVSEEGNVSGYRSGPSFAAVSSFGDSAEEEEDIVSKKTGIEENLAVNDSIWDQLVEIVKFSGPAAGLWLCGPLMSLIDTAVIGQSSSVELAALGPGTVLCDYMSYGFMFLSVATSNMVATSLAKQDKSEVQHQLSTLLFVGLACGLLMLFFTRFYGEW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G061570`
TK1151 ID	TkA06G061570
OH-1004 ID	LXL04_025404
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G061570

Location Chr06:16606140-16609414 (+)

Description Similar to DTX46: Protein DETOXIFICATION 46, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21340`	Protein DETOXIFICATION 46, chloroplastic.	No verified direct reference in this release
`At4g39030`	Functions as a multidrug and toxin extrusion transporter in the export of salicylic acid (SA) from the chloroplast to the cytoplasm.	EDS5, an essential component of salicylic acid-dependent signaling for disease resistance in Arabidopsis, is a member of the MATE transporter family.2002 · DOI: 10.1105/tpc.010376 Age-related resistance in Arabidopsis is a developmentally regulated defense response to Pseudomonas syringae.2002 · DOI: 10.1105/tpc.010481 Forward and reverse genetics to identify genes involved in the age-related resistance response in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1364-3703.2009.00557.x Export of salicylic acid from the chloroplast requires the multidrug and toxin extrusion-like transporter EDS5.2013 · DOI: 10.1104/pp.113.218156 Investigation of intercellular salicylic acid accumulation during compatible and incompatible Arabidopsis-pseudomonas syringae interactions using a fast neutron-generated mutant allele of EDS5 identified by genetic mapping and whole-genome sequencing.2014 · DOI: 10.1371/journal.pone.0088608
`At2g38330`	Protein DETOXIFICATION 44, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025404 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006952 defense response Biological Process

GO:0009624 response to nematode Biological Process

GO:0009697 salicylic acid biosynthetic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030001 metal ion transport Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT2G21340

ath:AT2G38330

ath:AT3G08040

ath:AT4G38380

ath:AT4G39030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · TkA06G061570 · TK1151

Peroxisome0.022

Rank 2 · TkA06G061570 · TK1151

Golgi apparatus0.021

Rank 3 · TkA06G061570 · TK1151

Cytoplasm0.019

Rank 4 · TkA06G061570 · TK1151

Mitochondrion0.018

Rank 5 · TkA06G061570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE171-322 aa

PF14110DUF4282219-271 aa

PF14110DUF4282327-352 aa

PF01554MatE385-533 aa

PF14110DUF4282548-548 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G061570	`PF01554`	MatE	171	322	1.1e-16	61.6
TkA06G061570	`PF14110`	DUF4282	219	271	0.38	12.1
TkA06G061570	`PF14110`	DUF4282	327	352	0.38	12.1
TkA06G061570	`PF01554`	MatE	385	533	1.1e-16	61.6
TkA06G061570	`PF14110`	DUF4282	548	548	0.38	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4G3`	Arabidopsis thaliana	sp\|Q8W4G3\|DTX46_ARATH Protein DETOXIFICATION 46, chloroplastic	71.100%	Swiss-Prot	High
`Q945F0`	Arabidopsis thaliana	sp\|Q945F0\|DTX47_ARATH Protein DETOXIFICATION 47, chloroplastic	66.000%	Swiss-Prot	High
`Q84K71`	Arabidopsis thaliana	sp\|Q84K71\|DTX44_ARATH Protein DETOXIFICATION 44, chloroplastic	24.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card