TkA06G027960 | RubberDandelionOmics

Gene overview

TkA06G027960

Reference: TK1151 Chr: Chr06 Coordinates: 7559506-7560180 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · TkA06G027960|TK1151|cDNA

ATGACAGTTGAAGATTCAGATTTTTACGATTTTGATAAACTAAGAGTAGAAAAGAGTTTCAAAAAAGGACAAATATGGGCATTGTACGATGACGATGATGGAATGCCAAGACATTACGGTTTAATAAATCAAGTAACATCAACAAATCCATTTGAAGTCGACATGTCATGTGAAAGGGCAGCGAAAGAAGTGTACAGGATTTACCCCAAGAAGGGGTCAGTGTGGGCCCTATATAACGACACAAAAGACAAAAAATGTTA...

CDS

Download CDS FASTA

537 bp · TkA06G027960|TK1151|CDS

ATGACAGTTGAAGATTCAGATTTTTACGATTTTGATAAACTAAGAGTAGAAAAGAGTTTCAAAAAAGGACAAATATGGGCATTGTACGATGACGATGATGGAATGCCAAGACATTACGGTTTAATAAATCAAGTAACATCAACAAATCCATTTGAAGTCGACATGTCATGTGAAAGGGCAGCGAAAGAAGTGTACAGGATTTACCCCAAGAAGGGGTCAGTGTGGGCCCTATATAACGACACAAAAGACAAAAAATGTTA...

Protein

Download Protein FASTA

178 aa · TkA06G027960|TK1151|PROTEIN

MTVEDSDFYDFDKLRVEKSFKKGQIWALYDDDDGMPRHYGLINQVTSTNPFEVDMSCERAAKEVYRIYPKKGSVWALYNDTKDKKCYDIVVFLTSYSEVHGLSMGYLEKVNGFKTIFRRQEVGFRAVRWLEKHDTRLFSHQIPARKVSGEEVLEVSGDCWELDPASLPSDLLTIGCKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G027960`
TK1151 ID	TkA06G027960
OH-1004 ID	LXL04_026092
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	75.400
Protein coverage (%)	TK1151 100.000 / OH-1004 40.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G027960`
Location	Chr06:7559506-7560180 (+)
Description	Similar to dnaJ: Chaperone protein DnaJ (Helicobacter pylori (strain ATCC 700392 / 26695)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026092` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0071218 cellular response to misfolded protein Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0030544 Hsp70 protein binding Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	ath:AT5G49060 heo:C694_06875 hpj:jhp_1252 hpy:HP_1332 mma:MM_2504 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · TkA06G027960 · TK1151

Cytoplasm0.149

Rank 2 · TkA06G027960 · TK1151

Cell membrane0.034

Rank 3 · TkA06G027960 · TK1151

Extracellular0.029

Rank 4 · TkA06G027960 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA06G027960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11926DUF34441-56 aa

PF13154DUF399121-44 aa

PF09149DUF193522-31 aa

PF11926DUF344447-151 aa

PF09149DUF193562-100 aa

PF13154DUF399169-86 aa

PF25386Chromo_SEND194-103 aa

PF25386Chromo_SEND1142-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G027960	`PF11926`	DUF3444	1	56	1.5e-47	162.6
TkA06G027960	`PF13154`	DUF3991	21	44	0.26	12.4
TkA06G027960	`PF09149`	DUF1935	22	31	0.00071	20.4
TkA06G027960	`PF11926`	DUF3444	47	151	1.5e-47	162.6
TkA06G027960	`PF09149`	DUF1935	62	100	0.00071	20.4
TkA06G027960	`PF13154`	DUF3991	69	86	0.26	12.4
TkA06G027960	`PF25386`	Chromo_SEND1	94	103	0.19	12.3
TkA06G027960	`PF25386`	Chromo_SEND1	142	176	0.19	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card