RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G011210
Reference: TK1151 Chr: Chr06 Coordinates: 2923977-2928185 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2615 bp · TkA06G011210|TK1151|cDNA

AACCGAACATCCTCACTTTACAAAATTCATTCGGTATCTCCACATCATTTCCGTTTGCTGCTTCTCTATAATTTCTTCAAGTTTCTCTAATATTACCACCAAATCTATCTTCGTCTTCAAGTTTTGTTCAACTGGGAATTGCTTTAACTTCTTAAATTTCACTTTCCAATCATCTTTTTGTTTCCTTTTTCTACCGATTTGGTTCAGTGTGTTGCTGTTAAAAGGATTCACACATTTACAATCGTCAAGCTCCATCCCGC...

CDS

Download CDS FASTA

1983 bp · TkA06G011210|TK1151|CDS

ATGAAACGATTGGTTTCATTGCAACTTATATGTGTTTGTTTGGGACTGTTTCTTGCTACCAGTAATGCTGTTCTACCAACAGAAGTTCATGCCCTCACAGTGTTCAAAGAAGCTATATTTGACGACCCATTATTGGTTTTGTCAAACTGGAATGGCTTAGATTCCGATCCTTGTAATTGGGTTGGTGTTTACTGTTCTGAAGATCATGTTAGAAAAGTTAACATTTCTGGCTTTTCCATAAAGGGATTCATAGCTGAAGA...

Protein

Download Protein FASTA

660 aa · TkA06G011210|TK1151|PROTEIN

MKRLVSLQLICVCLGLFLATSNAVLPTEVHALTVFKEAIFDDPLLVLSNWNGLDSDPCNWVGVYCSEDHVRKVNISGFSIKGFIAEELFQLSFLHELILHGNNLIGSIPKEIGTLKHLKILDLGMNQLSGPIPNQIGDLASVIKINLQYNALTGKMPSELGNLKYLQELRLDRNKLEGTIPGGNSTDFASSMRVIYASSTNANPLGFCRATPLKIADFSYNYLVGSVPKCLEYLPKASFQGNCIKYKGITTRPPAQCGFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G011210
TK1151 IDTkA06G011210
OH-1004 IDLXL04_026463
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)94.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G011210
LocationChr06:2923977-2928185 (+)
DescriptionSimilar to At1g63430: Probable LRR receptor-like serine/threonine-protein kinase At1g63430
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g63430 Probable LRR receptor-like serine/threonine-protein kinase At1g63430. No verified direct reference in this release
At4g18640 Involved in the pollen tube perception of the female signal by binding an unidentified female attractant.
Analysis of the root-hair morphogenesis transcriptome reveals the molecular identity of six genes with roles in root-hair development in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02609.x
At5g45840 Involved in the pollen tube perception of the female signal.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
At3g56050 Probable inactive receptor-like protein kinase At3g56050. No verified direct reference in this release
At2g40270 Inactive receptor-like serine/threonine-protein kinase At2g40270. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026463 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0048765 root hair cell differentiation Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0012505 endomembrane system Cellular Component
GO:0090406 pollen tube Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G63430
ath:AT2G40270
ath:AT3G56050
ath:AT4G18640
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.829
Rank 1 · TkA06G011210 · TK1151
Endoplasmic reticulum0.080
Rank 2 · TkA06G011210 · TK1151
Cytoplasm0.078
Rank 3 · TkA06G011210 · TK1151
Nucleus0.061
Rank 4 · TkA06G011210 · TK1151
Lysosome / Vacuole0.029
Rank 5 · TkA06G011210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_226-66 aa
PF00560LRR_170-91 aa
PF23211LRR_LRWD187-129 aa
PF23598LRR_1488-172 aa
PF13516LRR_692-106 aa
PF00560LRR_194-115 aa
PF13855LRR_894-152 aa
PF12799LRR_494-128 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G011210PF08263LRRNT_226661.7e-1144.9
TkA06G011210PF00560LRR_170914.7e-1347.2
TkA06G011210PF23211LRR_LRWD1871290.1912.1
TkA06G011210PF23598LRR_14881721.7e-0834.3
TkA06G011210PF13516LRR_6921060.5711.1
TkA06G011210PF00560LRR_1941154.7e-1347.2
TkA06G011210PF13855LRR_8941529.9e-1038.8
TkA06G011210PF12799LRR_4941288.2e-0833.0
TkA06G011210PF13516LRR_61161300.5711.1
TkA06G011210PF00560LRR_11171394.7e-1347.2
TkA06G011210PF13855LRR_81171769.9e-1038.8
TkA06G011210PF12799LRR_41421768.2e-0833.0
TkA06G011210PF00560LRR_11431634.7e-1347.2
TkA06G011210PF13516LRR_61441540.5711.1
TkA06G011210PF23211LRR_LRWD11561810.1912.1
TkA06G011210PF13516LRR_61641770.5711.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
C0LGH8Arabidopsis thalianasp|C0LGH8|Y1634_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g6343061.900%Swiss-ProtHigh
C0LGQ4Arabidopsis thalianasp|C0LGQ4|MDIS2_ARATH Protein MALE DISCOVERER 232.800%Swiss-ProtMedium
C0LGU7Arabidopsis thalianasp|C0LGU7|MDIS1_ARATH Protein MALE DISCOVERER 133.300%Swiss-ProtMedium
Q9LYN6Arabidopsis thalianasp|Q9LYN6|Y3565_ARATH Probable inactive receptor-like protein kinase At3g5605035.100%Swiss-ProtMedium
Q9SIZ4Arabidopsis thalianasp|Q9SIZ4|Y2027_ARATH Inactive receptor-like serine/threonine-protein kinase At2g4027035.200%Swiss-ProtMedium

JBrowse

View in Genome Browser