RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G451960
Reference: TK1151 Chr: Chr05 Coordinates: 113115260-113120997 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3169 bp · TkA05G451960|TK1151|cDNA

TAACGCTCCTACTACAATCAACGATCCAGAAACAACCAAATAATAATATCAAACAGGGGGAAATCGTGAAGCGGCGACGAAGATGACGAAAACACGCCATCTGAATCATCAAAAACAGCAGTTTCGCCTCATAAATACGGTTTTAATTCGAACTTCTCAGTCGACATTACCAATAATGTAACTATGGGATCAAAGTAGTTTGCTCGAGGTCGATGGAAGTATGCCGGAGAGTTGAATTTCGTTTCTATCGTGGAGAGAAA...

CDS

Download CDS FASTA

2517 bp · TkA05G451960|TK1151|CDS

ATGTATTGTTCTTTGGGTATGCTTCCTAAAGCTCATATTGGGTTTCTAACACAATTCTCTATTAAAGATTCATCAATGGCTACAGGAAGCAACTCTTATATCCCTCCACCACAGCTTACAAAACTTATCGTGGGACCCAGAAATCAGGCCTTCAGTTCAAGCCTTCTTCGTACCCCAAAATTATTTGCCCATTGTCAGGCGAACCATGATTCAGCTGTTGTGACTGATGATGAGCTTTCATCAATGACAAACATTAAAGC...

Protein

Download Protein FASTA

838 aa · TkA05G451960|TK1151|PROTEIN

MYCSLGMLPKAHIGFLTQFSIKDSSMATGSNSYIPPPQLTKLIVGPRNQAFSSSLLRTPKLFAHCQANHDSAVVTDDELSSMTNIKADMKTPRILKLDPALGPYKDHFEHRLKRFSEQKMLIEQHEGSLEEFAKGYLKFGLNKEEGGMVYREWAPAAEEAQLIGDFNGWDGSNHKMERNQFGVWSIKIPDVDGNSSIPHNSKVKFRFKSNGVWIDRIPAWIKFATVDSSRFAAPYDGVYWDPPPSERYEFKYPRPPKPKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G451960
TK1151 IDTkA05G451960
OH-1004 IDLXL04_022226
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.900
Protein coverage (%)TK1151 97.017 / OH-1004 98.070
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G451960
LocationChr05:113115260-113120997 (+)
DescriptionSimilar to SBE1: 1,4-alpha-glucan-branching enzyme
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g36390 Catalyzes the formation of the alpha-1,6-glucosidic linkages in starch by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0726400 Catalyzes the formation of the alpha-1,6-glucosidic linkages in starch by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005975 carbohydrate metabolic process Biological Process
GO:0005978 glycogen biosynthetic process Biological Process
GO:0005982 starch metabolic process Biological Process
GO:0005983 starch catabolic process Biological Process
GO:0010021 amylopectin biosynthetic process Biological Process
GO:0019252 starch biosynthetic process Biological Process
GO:0071329 cellular response to sucrose stimulus Biological Process
GO:0071332 cellular response to fructose stimulus Biological Process
GO:0071333 cellular response to glucose stimulus Biological Process
GO:0071482 cellular response to light stimulus Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0009501 amyloplast Cellular Component
KEGG gene cross-reference
ath:AT2G36390
sot:102596498
zma:542238
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953
Rank 1 · TkA05G451960 · TK1151
Cytoplasm0.054
Rank 2 · TkA05G451960 · TK1151
Mitochondrion0.035
Rank 3 · TkA05G451960 · TK1151
Cell membrane0.030
Rank 4 · TkA05G451960 · TK1151
Peroxisome0.030
Rank 5 · TkA05G451960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02922CBM_48138-220 aa
PF19513DUF6047271-315 aa
PF00128Alpha-amylase312-399 aa
PF00128Alpha-amylase394-459 aa
PF19513DUF6047614-669 aa
PF02806Alpha-amylase_C673-773 aa
PF12226Astro_capsid_p762-834 aa
PF06524NOA36770-832 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G451960PF02922CBM_481382204.7e-2072.4
TkA05G451960PF19513DUF60472713150.0315.0
TkA05G451960PF00128Alpha-amylase3123991.6e-1248.1
TkA05G451960PF00128Alpha-amylase3944591.6e-1248.1
TkA05G451960PF19513DUF60476146690.0315.0
TkA05G451960PF02806Alpha-amylase_C6737732.5e-2279.7
TkA05G451960PF12226Astro_capsid_p7628345.06.9
TkA05G451960PF06524NOA367708320.769.8
TkA05G451960PF15017WRNPLPNID7888381.310.6
TkA05G451960PF00428Ribosomal_60s8038332.89.3
TkA05G451960PF29089Protamine-38088317.27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O23647Arabidopsis thalianasp|O23647|GLGB1_ARATH 1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic56.400%Swiss-ProtHigh
Q01401Oryza sativa subsp. japonicasp|Q01401|GLGB_ORYSJ 1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic78.400%Swiss-ProtHigh

JBrowse

View in Genome Browser