RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G451950
Reference: TK1151 Chr: Chr05 Coordinates: 113112115-113115654 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1945 bp · TkA05G451950|TK1151|cDNA

AAGGAATTGCACCAAATATTTCGATTGCTTTGCTTTACGTCATAGTCGTTCTCCAAAGAAAAACACCATAGCAGACAATTTTGGAAAACTAACCCGACAAATATCGCCATGTGTTTCTCTCTATAGATCCACCTCTTTCTCTCCACGATAGAAACGAAATTCAACTCTCCGGCATACTTCCATCGACCTCGAGCAAACTACTTTGATCCCATAGTTACATTATTGGTAATGTCGACTGAGAAGTTCGAATTAAAACCGTA...

CDS

Download CDS FASTA

1332 bp · TkA05G451950|TK1151|CDS

ATGATTCAGATGGCGTGTTTTCGTCATCTTCGTCGCCGCTTCACGATTTCCCCCTGTTTGATATTATTATTTGGTTGTTTCTGGATCGTTGATTGTAGTAGGAGCGTTAATCATGTCTCACATCAACAACGGCGGCCTTCTATCACGCCTATCAATCGTGATCTTTATCACACTAGTGATACATTAATGAAAGAGGTAATAAAATTGGTCAAACGTCACCAAGACAGATTCCATATAGAGACATTTACAAGTTCAAATAA...

Protein

Download Protein FASTA

443 aa · TkA05G451950|TK1151|PROTEIN

MIQMACFRHLRRRFTISPCLILLFGCFWIVDCSRSVNHVSHQQRRPSITPINRDLYHTSDTLMKEVIKLVKRHQDRFHIETFTSSNKGYKADLNVVTYCQNITDIKDSSKLRILLSFGQHARELITSEVALKMLYILSEEQTLPKRNPVLLNRTLQNLIIKVVPIENLNGRAKVEAGEICERRNGRGVDLNRNWSVDWGKKEKDYDPKEENPGSGPFSEPESQMMRKLSRSFNPHIWVNVHSGMEALFMPYDHKNTTPPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G451950
TK1151 IDTkA05G451950
OH-1004 IDLXL04_022225
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)93.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G451950
LocationChr05:113112115-113115654 (-)
DescriptionSimilar to CPA6: Carboxypeptidase A6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022225 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002002 regulation of angiotensin levels in blood Biological Process
GO:0002003 angiotensin maturation Biological Process
GO:0006508 proteolysis Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005615 extracellular space Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0030133 transport vesicle Cellular Component
GO:0004180 carboxypeptidase activity Molecular Function
GO:0004181 metallocarboxypeptidase activity Molecular Function
GO:0008233 peptidase activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
mmu:232680
mmu:329093
rno:54242
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.413
Rank 1 · TkA05G451950 · TK1151
Golgi apparatus0.243
Rank 2 · TkA05G451950 · TK1151
Cytoplasm0.163
Rank 3 · TkA05G451950 · TK1151
Nucleus0.119
Rank 4 · TkA05G451950 · TK1151
Lysosome / Vacuole0.107
Rank 5 · TkA05G451950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00246Peptidase_M1468-337 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G451950PF00246Peptidase_M14683374.5e-30106.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser