TkA05G443030 | RubberDandelionOmics

Gene overview

TkA05G443030

Reference: TK1151 Chr: Chr05 Coordinates: 110689903-110694192 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2832 bp · TkA05G443030|TK1151|cDNA

CGTCCCTAATTCTTAACTCGATCTCCTCTCTCCCAAGTCCCAACTTTCAATTCGCAAACCAGTTCACTGCAATTACCATCCGCCCATCTTGTAAGGATGGTGTAACGATAGTGCCTCTTTTCTGCACATTGTTCAGTAATCCACTCTATAATATTAGAGCTATTTTTGATGGGTTCACCTGAACGTGTAAAGGCCTCTGTGAAAAGGGACATAGAAGACAGCTCAGGTTCTAGAAGTGACAGAGCCCGCGACCATGAAAC...

CDS

Download CDS FASTA

2625 bp · TkA05G443030|TK1151|CDS

ATGGGTTCACCTGAACGTGTAAAGGCCTCTGTGAAAAGGGACATAGAAGACAGCTCAGGTTCTAGAAGTGACAGAGCCCGCGACCATGAAACAAGTGAATCAGATGAGAGGAGAAAACGAAGGTCAGGAAAGTCAAAGCATTCCGGAAGTGGAGAAGAAGACAACAGTGCAAGAAGAAGAAGCAGTGAGGAAAAATACGAGAGCCGAAAAAGGACAGGTGGCAGCAAGGCATTGAGCGATGAAGACGAATACGAGTCAAG...

Protein

Download Protein FASTA

874 aa · TkA05G443030|TK1151|PROTEIN

MGSPERVKASVKRDIEDSSGSRSDRARDHETSESDERRKRRSGKSKHSGSGEEDNSARRRSSEEKYESRKRTGGSKALSDEDEYESRSKHMRKKQEESALETLSNWYQDGEGENRHDGGGGGERSERRKSTPKVKDDSDLEKDLKNSQRKEKSQRKRWDDADTVNNLEETSEKNQEDNEKAADDDDDVTRGKKDIDRASRKEKDSYKDDRSKGRDDNWQKRRQEKEKDDDAPYDYTRDWESPSSQRRGSGPRDRAETGGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G443030`
TK1151 ID	TkA05G443030
OH-1004 ID	LXL04_022052
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G443030

Location Chr05:110689903-110694192 (-)

Description Similar to MTB: N6-adenosine-methyltransferase non-catalytic subunit MTB

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09980`	Probable non-catalytic subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022052 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016556 mRNA modification Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0061157 mRNA destabilization Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0036396 RNA N6-methyladenosine methyltransferase complex Cellular Component

GO:0001734 mRNA m(6)A methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G09980

gga:422684

xla:414467

xtr:493301

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA05G443030 · TK1151

Cytoplasm0.160

Rank 2 · TkA05G443030 · TK1151

Cell membrane0.024

Rank 3 · TkA05G443030 · TK1151

Mitochondrion0.015

Rank 4 · TkA05G443030 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA05G443030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21729IRX15_IRX15L_GXM495-561 aa

PF05063MT-A70543-720 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G443030	`PF21729`	IRX15_IRX15L_GXM	495	561	0.074	13.3
TkA05G443030	`PF05063`	MT-A70	543	720	2.2e-51	174.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AI4`	Arabidopsis thaliana	sp\|Q94AI4\|METL1_ARATH N6-adenosine-methyltransferase non-catalytic subunit MTB	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card