RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G436670
Reference: TK1151 Chr: Chr05 Coordinates: 109017865-109021456 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2958 bp · TkA05G436670|TK1151|cDNA

AAATTAATAGAAAGCTTCACACGACGTGAGTGACCCAATTTAAAGGAGAGTGAGAGAGAAAGTTCTGTTCTTTTCTTTATTAGTTTCCCAATCGTATCAAAAAATTTGGGAATTGAAAATTTGTTTTTTTATAATACAAGAATCTCACACTCATCATCTTCCCTATCAGAGTTCCTTTGTTCTTCGTTTTCCCGTCTCCATTTTTCCTCGCGATTTCATAAACTAATAAAATTTCGAATTCTATCAAGCTGCCGACGCTC...

CDS

Download CDS FASTA

2292 bp · TkA05G436670|TK1151|CDS

ATGGTAGGAAAAGAAGATGAAGCTAGCGGGGACAGTAACACCATTGACAGTACTGGTTCACGACTGCATCATCCCATTCCAGGTAACAAAAAAATGTATTGGAGGTCTGCTTCATGGTCTTCTTCTCATGTATCATTACCACCACTCAATCCCGATAGTGTAAAAGACCCTTCAGATCCAAGCAACTCCGGGCAGATTCGAAGGTGTCCTGTCCCTCTAACTCCTAGATCATCAAACAGTAAAGGCCGTTCATTTCTCCC...

Protein

Download Protein FASTA

763 aa · TkA05G436670|TK1151|PROTEIN

MVGKEDEASGDSNTIDSTGSRLHHPIPGNKKMYWRSASWSSSHVSLPPLNPDSVKDPSDPSNSGQIRRCPVPLTPRSSNSKGRSFLPPLSIARRSLDEWPRAGSDDVGEWPIPSTPSGERLKLDLSSLQKIPDKNASLVKRDKIAFFDKKCSKVAEHIFLGGDAVARDKSILKQHKITHILNCVGFVCPEYFKGHFVYRTLWLQDSPSEDITSILYDVFDYFEDVRDQNGKVFVHCCQGVSRSTSLVIAYRMWREGQSFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G436670
TK1151 IDTkA05G436670
OH-1004 IDLXL04_021977
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.400
Protein coverage (%)TK1151 99.607 / OH-1004 98.842
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G436670
LocationChr05:109017865-109021456 (+)
DescriptionSimilar to MKP1: Protein-tyrosine-phosphatase MKP1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g55270 Protein-tyrosine-phosphatase that acts as a negative regulator of MPK6 and MPK3 signaling by dephosphorylating and repressing MPK6 and MPK3.
Mitogen-activated protein kinase phosphatase is required for genotoxic stress relief in Arabidopsis.2001 · DOI: 10.1101/gad.192601
Distinct regulation of salinity and genotoxic stress responses by Arabidopsis MAP kinase phosphatase 1.2002 · DOI: 10.1093/emboj/cdf646
The role of NADPH oxidase and MAP kinase phosphatase in UV-B-dependent gene expression in Arabidopsis.2006 · DOI: 10.1111/j.1365-3040.2006.01555.x
MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067678
Arabidopsis MAP Kinase Phosphatase 1 (AtMKP1) negatively regulates MPK6-mediated PAMP responses and resistance against bacteria.2011 · DOI: 10.1111/j.1365-313x.2011.04588.x
Arabidopsis MAP kinase phosphatase 1 is phosphorylated and activated by its substrate AtMPK6.2011 · DOI: 10.1007/s00299-011-1064-4
Arabidopsis MAP kinase phosphatase 1 and its target MAP kinases 3 and 6 antagonistically determine UV-B stress tolerance, independent of the UVR8 photoreceptor pathway.2011 · DOI: 10.1111/j.1365-313x.2011.04725.x

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021977 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006470 protein dephosphorylation Biological Process
GO:0006952 defense response Biological Process
GO:0007162 negative regulation of cell adhesion Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010224 response to UV-B Biological Process
GO:0010225 response to UV-C Biological Process
GO:0032355 response to estradiol Biological Process
GO:0032526 response to retinoic acid Biological Process
GO:0032870 cellular response to hormone stimulus Biological Process
GO:0033574 response to testosterone Biological Process
KEGG gene cross-reference
ath:AT3G55270
hsa:1843
mmu:19252
rno:114856
xla:380262
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.660
Rank 1 · TkA05G436670 · TK1151
Nucleus0.303
Rank 2 · TkA05G436670 · TK1151
Cell membrane0.082
Rank 3 · TkA05G436670 · TK1151
Golgi apparatus0.072
Rank 4 · TkA05G436670 · TK1151
Mitochondrion0.054
Rank 5 · TkA05G436670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00782DSPc158-288 aa
PF00102Y_phosphatase202-270 aa
PF22785Tc-R-P215-253 aa
PF22741PTP-NADK221-261 aa
PF25466MPK1_gelsolin_C329-351 aa
PF00626Gelsolin330-390 aa
PF25480DUF7904342-394 aa
PF25466MPK1_gelsolin_C376-392 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G436670PF00782DSPc1582883.2e-2589.2
TkA05G436670PF00102Y_phosphatase2022700.0009119.6
TkA05G436670PF22785Tc-R-P2152530.02415.9
TkA05G436670PF22741PTP-NADK2212611.1e-0525.7
TkA05G436670PF25466MPK1_gelsolin_C3293512.8e-2382.8
TkA05G436670PF00626Gelsolin3303905.2e-0626.9
TkA05G436670PF25480DUF79043423940.0004620.7
TkA05G436670PF25466MPK1_gelsolin_C3763922.8e-2382.8
TkA05G436670PF22741PTP-NADK6546981.1e-0525.7
TkA05G436670PF25466MPK1_gelsolin_C6677602.8e-2382.8
TkA05G436670PF00626Gelsolin6727565.2e-0626.9
TkA05G436670PF25480DUF79047267600.0004620.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C5S1Arabidopsis thalianasp|Q9C5S1|MKP1_ARATH Protein-tyrosine-phosphatase MKP150.600%Swiss-ProtHigh

JBrowse

View in Genome Browser