TkA05G433180 | RubberDandelionOmics

Gene overview

TkA05G433180

Reference: TK1151 Chr: Chr05 Coordinates: 108093045-108096011 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2967 bp · TkA05G433180|TK1151|cDNA

ATGAGATCCCAGAAGGAAAATTCATCCTTAAAAGTGGCACTTCGTGTATCTTCATGCAATCTTCTTCCAGATCTTGACCTCGAGAAATTTGATCCTATTCTCCATATAATGATTGAGTTTCTAAAAGGTCACCCGATTCACAAACCCTTGACCAAGTCAACCGAGTTTCCTCTAAGCATCATCCATACAGCTTACTCAACTGCTGTATATAACTGTGAGGAAGATTGCATTAAGTTCAACATCAATGAAGATAACATTAC...

CDS

Download CDS FASTA

2967 bp · TkA05G433180|TK1151|CDS

ATGAGATCCCAGAAGGAAAATTCATCCTTAAAAGTGGCACTTCGTGTATCTTCATGCAATCTTCTTCCAGATCTTGACCTCGAGAAATTTGATCCTATTCTCCATATAATGATTGAGTTTCTAAAAGGTCACCCGATTCACAAACCCTTGACCAAGTCAACCGAGTTTCCTCTAAGCATCATCCATACAGCTTACTCAACTGCTGTATATAACTGTGAGGAAGATTGCATTAAGTTCAACATCAATGAAGATAACATTAC...

Protein

Download Protein FASTA

988 aa · TkA05G433180|TK1151|PROTEIN

MRSQKENSSLKVALRVSSCNLLPDLDLEKFDPILHIMIEFLKGHPIHKPLTKSTEFPLSIIHTAYSTAVYNCEEDCIKFNINEDNITKLSKEVFLKAIGFPENKEKTTSYEPTNEEIFDVLDQMGYLPPRIEQTKNFRKGKLPAMWQFLVHFLLRCLTGKTGGTDTVNRSFLVLIFGIYTGKEVDIGAFLWKDFVSYVFPKKKEIPCARFWALALQMMYEKMKVKVKLPEGEKMFTPRPISRYIISDQLDFGKVYRLPEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G433180`
TK1151 ID	TkA05G433180
OH-1004 ID	LXL04_021954
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.200
Protein coverage (%)	TK1151 99.595 / OH-1004 78.088 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G433180`
Location	Chr05:108093045-108096011 (+)
Description	Similar to HEXBP: DNA-binding protein HEXBP
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_021954` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.821

Rank 1 · TkA05G433180 · TK1151

Cytoplasm0.235

Rank 2 · TkA05G433180 · TK1151

Mitochondrion0.034

Rank 3 · TkA05G433180 · TK1151

Cell membrane0.022

Rank 4 · TkA05G433180 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA05G433180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22516PreP_C522-606 aa

PF20936GCIP_C541-590 aa

PF06825HSBP1549-588 aa

PF25887HB_LcnD559-619 aa

PF12918TcdB_N579-611 aa

PF07554FIVAR583-654 aa

PF20936GCIP_C616-654 aa

PF06825HSBP1635-656 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G433180	`PF22516`	PreP_C	522	606	0.19	12.2
TkA05G433180	`PF20936`	GCIP_C	541	590	0.022	15.8
TkA05G433180	`PF06825`	HSBP1	549	588	6.3	7.4
TkA05G433180	`PF25887`	HB_LcnD	559	619	0.011	16.4
TkA05G433180	`PF12918`	TcdB_N	579	611	0.18	12.8
TkA05G433180	`PF07554`	FIVAR	583	654	1.2	10.5
TkA05G433180	`PF20936`	GCIP_C	616	654	0.022	15.8
TkA05G433180	`PF06825`	HSBP1	635	656	6.3	7.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card