TkA04G517560 | RubberDandelionOmics

Gene overview

TkA04G517560

Reference: TK1151 Chr: Chr04 Coordinates: 130799799-130801434 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1141 bp · TkA04G517560|TK1151|cDNA

TGGAAGCCTCTAAATCCTCATGAAAAGGGGAACTTGAAAGTTAAACCCTTCAAAAACGTTAAAGTTAACAGAAAAGATTGGTCAAAACCAACTACAAAAGTCTCGATTACCGAAGAGTTTCCACTTGAAAAATTACGTGGTCCAATTAGTGTTGAGCTCCATGAAACATGGGAGGCACAACAACATTCAAAAGATTACGAACCACAATCTCCGCCATATTATGAAAAGCTTCGACAATCACTTGTTGAAGGAGACCATGA...

CDS

Download CDS FASTA

741 bp · TkA04G517560|TK1151|CDS

TGGAAGCCTCTAAATCCTCATGAAAAGGGGAACTTGAAAGTTAAACCCTTCAAAAACGTTAAAGTTAACAGAAAAGATTGGTCAAAACCAACTACAAAAGTCTCGATTACCGAAGAGTTTCCACTTGAAAAATTACGTGGTCCAATTAGTGTTGAGCTCCATGAAACATGGGAGGCACAACAACATTCAAAAGATTACGAACCACAATCTCCGCCATATTATGAAAAGCTTCGACAATCACTTGTTGAAGGAGACCATGA...

Protein

Download Protein FASTA

246 aa · TkA04G517560|TK1151|PROTEIN

WKPLNPHEKGNLKVKPFKNVKVNRKDWSKPTTKVSITEEFPLEKLRGPISVELHETWEAQQHSKDYEPQSPPYYEKLRQSLVEGDHEDIGTFNNDKDDEDDGYDNGGHDFHPYDDYMNEDHFNHENHMDDATKFDGKEPVENEEPINANENLEDLCRSHLDSLLASIAEEKQTALAARVSTWKQRIDQNLEEQDARPPFDIHEYCQRTLDKLSVQSDIGDSMSFTVVVSVLENTTSLEHSPHFSNW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G517560`
TK1151 ID	TkA04G517560
OH-1004 ID	LXL04_039280
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 94.309 / OH-1004 35.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G517560

Location Chr04:130799799-130801434 (+)

Description Similar to CAPH2: Condensin-2 complex subunit H2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16730`	Regulatory subunit of the condensin-2 complex, a complex that seems to provide chromosomes with an additional level of organization and rigidity and in establishing mitotic chromosome architecture (By similarity).	Condensin II alleviates DNA damage and is essential for tolerance of boron overload stress in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086314

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039280 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006974 DNA damage response Biological Process

GO:0007076 mitotic chromosome condensation Biological Process

GO:0007143 female meiotic nuclear division Biological Process

GO:0010032 meiotic chromosome condensation Biological Process

GO:0045739 positive regulation of DNA repair Biological Process

GO:0051306 mitotic sister chromatid separation Biological Process

GO:0051309 female meiosis chromosome separation Biological Process

GO:0051984 positive regulation of chromosome segregation Biological Process

GO:1905820 positive regulation of chromosome separation Biological Process

GO:1905821 positive regulation of chromosome condensation Biological Process

GO:0000793 condensed chromosome Cellular Component

GO:0000794 condensed nuclear chromosome Cellular Component

KEGG gene cross-reference

ath:AT3G16730

hsa:29781

mmu:52683

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.618

Rank 1 · TkA04G517560 · TK1151

Cytoplasm0.418

Rank 2 · TkA04G517560 · TK1151

Mitochondrion0.055

Rank 3 · TkA04G517560 · TK1151

Cell membrane0.054

Rank 4 · TkA04G517560 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA04G517560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14712Snapin_Pallidin52-79 aa

PF16858CNDH2_C152-233 aa

PF14712Snapin_Pallidin168-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G517560	`PF14712`	Snapin_Pallidin	52	79	0.13	13.4
TkA04G517560	`PF16858`	CNDH2_C	152	233	8.7e-22	78.2
TkA04G517560	`PF14712`	Snapin_Pallidin	168	207	0.13	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUR0`	Arabidopsis thaliana	sp\|Q9LUR0\|CNDH2_ARATH Condensin-2 complex subunit H2	51.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card