TkA04G127580 | RubberDandelionOmics

Gene overview

TkA04G127580

Reference: TK1151 Chr: Chr04 Coordinates: 33157321-33157860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · TkA04G127580|TK1151|cDNA

ATGGGACCATATATCGATCGCGAGTATACCCGGGATGTACGAAAGAACCGTGACTATGAACTCATTAGGGAAGACTTTTTCGTTAACAGGGTGGAAAATCGGGTGGGCGATCGCCCCGCCGCACTTACTATGGGGGGTGAAGCAGGCGCATTCGTATCTGACGTTTGCGACGTCCACCCCGATGCAGTACGCCGCCGCGGTAGCGTTGAGTACCCGGACGCGTACTACGAGGAGTTGAGGAAGGATTACAGGGCTAAGAA...

CDS

Download CDS FASTA

540 bp · TkA04G127580|TK1151|CDS

ATGGGACCATATATCGATCGCGAGTATACCCGGGATGTACGAAAGAACCGTGACTATGAACTCATTAGGGAAGACTTTTTCGTTAACAGGGTGGAAAATCGGGTGGGCGATCGCCCCGCCGCACTTACTATGGGGGGTGAAGCAGGCGCATTCGTATCTGACGTTTGCGACGTCCACCCCGATGCAGTACGCCGCCGCGGTAGCGTTGAGTACCCGGACGCGTACTACGAGGAGTTGAGGAAGGATTACAGGGCTAAGAA...

Protein

Download Protein FASTA

179 aa · TkA04G127580|TK1151|PROTEIN

MGPYIDREYTRDVRKNRDYELIREDFFVNRVENRVGDRPAALTMGGEAGAFVSDVCDVHPDAVRRRGSVEYPDAYYEELRKDYRAKKEILVEGLKAVGFRVFPSSGTYFVVVDHTVFGLPDDVAFCEYLIKEVGVVAIPTSVFYLDKEEGKNLVRFTFCKDEGTLRSAVERMKERLVRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G127580`
TK1151 ID	TkA04G127580
OH-1004 ID	LXL04_035484
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 60.335 / OH-1004 23.894 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G127580`
Location	Chr04:33157321-33157860 (+)
Description	Similar to dapC: Probable N-succinyldiaminopimelate aminotransferase DapC (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035484` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006103 2-oxoglutarate metabolic process Biological Process GO:0006520 amino acid metabolic process Biological Process GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process GO:0070189 kynurenine metabolic process Biological Process GO:0097053 L-kynurenine catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0008483 transaminase activity Molecular Function GO:0009016 succinyldiaminopimelate transaminase activity Molecular Function GO:0010326 methionine-oxo-acid transaminase activity Molecular Function GO:0016212 kynurenine-oxoglutarate transaminase activity Molecular Function GO:0030170 pyridoxal phosphate binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0287269 ecj:JW0593 eco:b0600 ecoc:C3026_03000 mmu:229905 mtc:MT0881 mtu:Rv0858c mtv:RVBD_0858c These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.687

Rank 1 · TkA04G127580 · TK1151

Nucleus0.323

Rank 2 · TkA04G127580 · TK1151

Peroxisome0.072

Rank 3 · TkA04G127580 · TK1151

Mitochondrion0.054

Rank 4 · TkA04G127580 · TK1151

Plastid0.043

Rank 5 · TkA04G127580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_275-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G127580	`PF00155`	Aminotran_1_2	75	171	7.6e-10	39.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card