TkA04G110920 | RubberDandelionOmics

Gene overview

TkA04G110920

Reference: TK1151 Chr: Chr04 Coordinates: 28827807-28832574 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

935 bp · TkA04G110920|TK1151|cDNA

ATATAAATCAACCCACCTTCCGTCATTCTTTGTTATTCCAAACACTTTCCACAATCATATTCAAAGCGCAAAAAGGGCCCCAAATATATTGGAAAGACAATTAGAAGAAGAAGATGGAGGCCACACGATCAAGATTTAAAAGTGTGTGTGTTTTCTGTGGTAGCAGTGCTGGCAAAAGAGATTGTTACAGAGATGCTGCTCTTGATCTTGGCCAAGAACTGGTGAAAAGGAAACTGGATCTTGTTTATGGTGGAGGGAGT...

CDS

Download CDS FASTA

651 bp · TkA04G110920|TK1151|CDS

ATGGAGGCCACACGATCAAGATTTAAAAGTGTGTGTGTTTTCTGTGGTAGCAGTGCTGGCAAAAGAGATTGTTACAGAGATGCTGCTCTTGATCTTGGCCAAGAACTGGTGAAAAGGAAACTGGATCTTGTTTATGGTGGAGGGAGTGTAGGGTTAATGGGATTGGTCTCACAGGAAGTTCACCATGGTGGTGGCCATGTTTTAGGTATTATTCCCAAGACTCTCATGTGCAAGGAGATAACAGGTGAAACAATAGGAGA...

Protein

Download Protein FASTA

216 aa · TkA04G110920|TK1151|PROTEIN

MEATRSRFKSVCVFCGSSAGKRDCYRDAALDLGQELVKRKLDLVYGGGSVGLMGLVSQEVHHGGGHVLGIIPKTLMCKEITGETIGELKVVSNMHQRKAEMARHSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNSLLSFIDKAVDDGFILPVQRHIIISATNAKDLVQKLEDYVPMHDGVVAKARWEDEQVELNASLHLELDR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G110920`
TK1151 ID	TkA04G110920
OH-1004 ID	LXL04_035751
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G110920

Location Chr04:28827807-28832574 (-)

Description Similar to LOG5: Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35190`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release
`At2g28305`	Cytokinin-activating enzyme working in the direct activation pathway.	Functional analyses of LONELY GUY cytokinin-activating enzymes reveal the importance of the direct activation pathway in Arabidopsis.2009 · DOI: 10.1105/tpc.109.068676
`At5g06300`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release
`At2g37210`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0628000`	Cytokinin-activating enzyme working in the direct activation pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035751 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009691 cytokinin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0102682 cytokinin riboside 5'-monophosphate phosphoribohydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G28305

ath:AT2G37210

ath:AT4G35190

ath:AT5G06300

osa:107275650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · TkA04G110920 · TK1151

Nucleus0.376

Rank 2 · TkA04G110920 · TK1151

Mitochondrion0.105

Rank 3 · TkA04G110920 · TK1151

Cell membrane0.062

Rank 4 · TkA04G110920 · TK1151

Peroxisome0.060

Rank 5 · TkA04G110920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18306LDcluster416-125 aa

PF03641Lysine_decarbox53-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G110920	`PF18306`	LDcluster4	16	125	2.2e-14	54.1
TkA04G110920	`PF03641`	Lysine_decarbox	53	183	3.6e-47	160.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBB7`	Arabidopsis thaliana	sp\|Q8LBB7\|LOG5_ARATH Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG5	79.300%	Swiss-Prot	High
`Q8RUN2`	Arabidopsis thaliana	sp\|Q8RUN2\|LOG1_ARATH Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG1	72.000%	Swiss-Prot	High
`Q8GW29`	Arabidopsis thaliana	sp\|Q8GW29\|LOG7_ARATH Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG7	74.100%	Swiss-Prot	High
`Q8L8B8`	Arabidopsis thaliana	sp\|Q8L8B8\|LOG3_ARATH Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG3	73.000%	Swiss-Prot	High
`B9F166`	Oryza sativa subsp. japonica	sp\|B9F166\|LOGL2_ORYSJ Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL2	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card