Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1704 bp · TkA03G581650|TK1151|cDNA
AAGTATGATTCATATTATTTTTTCCATCAGTTTTTTAGTAGTCGTGAAAATGTAGAGGATTGGGTGCGAAATGTAGGATGGAATCTCGGGTATGTGGTTGTTACTAGAAGAACAAAGCAAAAAAATGGCTATTTGTCGAGAGTTATTTTTATGTGTGATCGGGGTGGTGTGTTTAAAGAACAGGAGACGTCCTCCAGAAATACTGGAACAAGAAAAATAGATTGTCCATTCGAATTGCATGCTTGTTACTATAAGTCAAA...
1704 bp · TkA03G581650|TK1151|CDS
AAGTATGATTCATATTATTTTTTCCATCAGTTTTTTAGTAGTCGTGAAAATGTAGAGGATTGGGTGCGAAATGTAGGATGGAATCTCGGGTATGTGGTTGTTACTAGAAGAACAAAGCAAAAAAATGGCTATTTGTCGAGAGTTATTTTTATGTGTGATCGGGGTGGTGTGTTTAAAGAACAGGAGACGTCCTCCAGAAATACTGGAACAAGAAAAATAGATTGTCCATTCGAATTGCATGCTTGTTACTATAAGTCAAA...
Protein
Download Protein FASTA567 aa · TkA03G581650|TK1151|PROTEIN
KYDSYYFFHQFFSSRENVEDWVRNVGWNLGYVVVTRRTKQKNGYLSRVIFMCDRGGVFKEQETSSRNTGTRKIDCPFELHACYYKSNDVWMLKVKNDQHNHEPAMFLEGHPFARRLTPKEVEMVAEMRRNNVPPWKILEVLKSHNENNVSTIKTIYNESNKIRIDERAGRSQMQVVFGFLHSKKYIFEYRKNDTTNALEDIFFVHPTSLVICRAFPQIMMMDATYKTNKYKMPFLEIVGVTSTNTTFCIGFGFMNEEKES...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G581650 |
|---|---|
| TK1151 ID | TkA03G581650 |
| OH-1004 ID | LXL04_030089 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.900 |
| Protein coverage (%) | TK1151 66.314 / OH-1004 84.685Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G581650 |
|---|---|
| Location | Chr03:147655148-147656992 (-) |
| Description | Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0009403 toxin biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0004312 fatty acid synthase activity Molecular Function GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function GO:0008168 methyltransferase activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016853 isomerase activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G52520 ath:AT2G27110 ath:AT2G32250 ath:AT4G38180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08731AFT12-102 aaPF03101FAR127-102 aaPF15292Treslin_M86-142 aaPF07261DnaB_2112-155 aaPF03101FAR1126-146 aaPF28854Ig_BT4661_3rd140-197 aaPF08731AFT191-214 aaPF21056ZSWIM1-3_RNaseH-like192-302 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G581650 | PF08731 | AFT | 12 | 102 | 1.1e-07 | 32.8 |
| TkA03G581650 | PF03101 | FAR1 | 27 | 102 | 8e-05 | 24.0 |
| TkA03G581650 | PF15292 | Treslin_M | 86 | 142 | 0.058 | 14.2 |
| TkA03G581650 | PF07261 | DnaB_2 | 112 | 155 | 0.04 | 14.4 |
| TkA03G581650 | PF03101 | FAR1 | 126 | 146 | 8e-05 | 24.0 |
| TkA03G581650 | PF28854 | Ig_BT4661_3rd | 140 | 197 | 0.12 | 13.3 |
| TkA03G581650 | PF08731 | AFT | 191 | 214 | 1.1e-07 | 32.8 |
| TkA03G581650 | PF21056 | ZSWIM1-3_RNaseH-like | 192 | 302 | 2.9e-12 | 47.3 |
| TkA03G581650 | PF10551 | MULE | 219 | 313 | 2.1e-26 | 92.9 |
| TkA03G581650 | PF00872 | Transposase_mut | 252 | 322 | 0.024 | 14.3 |
| TkA03G581650 | PF13610 | DDE_Tnp_IS240 | 266 | 302 | 0.014 | 16.2 |
| TkA03G581650 | PF04513 | Baculo_PEP_C | 385 | 444 | 0.15 | 12.8 |
| TkA03G581650 | PF13610 | DDE_Tnp_IS240 | 392 | 413 | 0.014 | 16.2 |
| TkA03G581650 | PF10551 | MULE | 417 | 441 | 2.1e-26 | 92.9 |
| TkA03G581650 | PF08731 | AFT | 431 | 456 | 1.1e-07 | 32.8 |
| TkA03G581650 | PF04434 | SWIM | 481 | 508 | 0.19 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.