TkA03G473790 | RubberDandelionOmics

Gene overview

TkA03G473790

Reference: TK1151 Chr: Chr03 Coordinates: 118443631-118446569 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · TkA03G473790|TK1151|cDNA

ATGGCGTTTACGACGACGATGCTGGCGTGGAGTGTGATTGAGTTTGGGGAAATGATGCCGGCGGCGGATTTGAGGAATGCGTTGGTAGCGATTAGGTGGTCCACTGATTATCTGCTGAAGACGGTGGCGCAACCGGATCGGATTGTTGTACAGGTTGGTGAGCCAATGAATGACCACAATTGTTGGGAAAGGCCAGAAGACATGGACACGGCTCGAACCGTGTACACAGTCAGTGCACCGAACCCAGCCTCAGATGTAGC...

CDS

Download CDS FASTA

1251 bp · TkA03G473790|TK1151|CDS

ATGGCGTTTACGACGACGATGCTGGCGTGGAGTGTGATTGAGTTTGGGGAAATGATGCCGGCGGCGGATTTGAGGAATGCGTTGGTAGCGATTAGGTGGTCCACTGATTATCTGCTGAAGACGGTGGCGCAACCGGATCGGATTGTTGTACAGGTTGGTGAGCCAATGAATGACCACAATTGTTGGGAAAGGCCAGAAGACATGGACACGGCTCGAACCGTGTACACAGTCAGTGCACCGAACCCAGCCTCAGATGTAGC...

Protein

Download Protein FASTA

416 aa · TkA03G473790|TK1151|PROTEIN

MAFTTTMLAWSVIEFGEMMPAADLRNALVAIRWSTDYLLKTVAQPDRIVVQVGEPMNDHNCWERPEDMDTARTVYTVSAPNPASDVAGETAAALAASSMAFRSSDPGYSDTLLRTAIRVFEFADTYRGAYSDNADIREGACPYYCDFDGYQDELLWGAAWLRRASGGEKYLDYIQNNGKTLGADENINEFGWDNKHAGLNVLVSKEVLENNLYNLQSYKASADSFMCTLIPDSSYSHMEYTPGGLIFRPGGSNLQHSTTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G473790`
TK1151 ID	TkA03G473790
OH-1004 ID	LXL04_009802
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 99.279 / OH-1004 81.890 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G473790

Location Chr03:118443631-118446569 (+)

Description Similar to At4g39010: Endoglucanase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39010`	Endoglucanase 24.	No verified direct reference in this release
`At1g70710`	Required for cellulose formation of the cell wall.	Abnormal 'wrinkled' cell walls and retarded development of transgenic Arabidopsis thaliana plants expressing endo-1,4-beta-glucanase (cell) antisense.2003 · DOI: 10.1023/a:1021162321527
`At4g39000`	Endoglucanase 23.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0530200`	Endoglucanase 23.	No verified direct reference in this release
`Os06g0256900`	Endoglucanase 17.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009802 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009828 plant-type cell wall loosening Biological Process

GO:0010047 fruit dehiscence Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0042547 cell wall modification involved in multidimensional cell growth Biological Process

GO:0071555 cell wall organization Biological Process

GO:1990059 fruit valve development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23210

ath:AT1G70710

ath:AT4G39010

dosa:Os06g0256900

dosa:Os09g0530200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.420

Rank 1 · TkA03G473790 · TK1151

Extracellular0.332

Rank 2 · TkA03G473790 · TK1151

Cytoplasm0.115

Rank 3 · TkA03G473790 · TK1151

Lysosome / Vacuole0.112

Rank 4 · TkA03G473790 · TK1151

Endoplasmic reticulum0.086

Rank 5 · TkA03G473790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759Glyco_hydro_91-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G473790	`PF00759`	Glyco_hydro_9	1	403	4.7e-124	415.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YQ7`	Arabidopsis thaliana	sp\|Q93YQ7\|GUN24_ARATH Endoglucanase 24	71.300%	Swiss-Prot	High
`Q9CAC1`	Arabidopsis thaliana	sp\|Q9CAC1\|GUN8_ARATH Endoglucanase 8	58.200%	Swiss-Prot	High
`Q8GY58`	Arabidopsis thaliana	sp\|Q8GY58\|GUN23_ARATH Endoglucanase 23	55.800%	Swiss-Prot	High
`Q69NF5`	Oryza sativa subsp. japonica	sp\|Q69NF5\|GUN23_ORYSJ Endoglucanase 23	68.000%	Swiss-Prot	High
`Q652F9`	Oryza sativa subsp. japonica	sp\|Q652F9\|GUN17_ORYSJ Endoglucanase 17	57.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card