TkA03G473150 | RubberDandelionOmics

Gene overview

TkA03G473150

Reference: TK1151 Chr: Chr03 Coordinates: 118279763-118285364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3837 bp · TkA03G473150|TK1151|cDNA

CATCACCTCAAAACAACAGTAAACACTAAACAGCATGTTTATGGAGCAGGTAGCCCAGCATTTAGTGGGCCCAACAATGTCGCTCCAATAACTTCACACTTTACCCCCATAATCCATATACTACAAATTTCGCATTTAAAAAGGGTATTTGTTGTACTCTGTAAATGATCGATCTTGCTTTCCTTTTTCGAAAAAAATTGATTCTTTTGATGATTTCACTTCCCTTTGCCTGTTTTGGCATCTCTAAGCTTAAATCTCTG...

CDS

Download CDS FASTA

2331 bp · TkA03G473150|TK1151|CDS

ATGGGATTCTCCTCAAGGGTTAATGTTCTTCTCTTCCTTTTAGTAATCTTTCGGCAAAAATGGTCTGTAATTGGCATTTCAAGAAGCAAGGTTCATATTGTTTACATGGGTCATAATACTTTCGCTGAGCCAATGATTGTTCAGGATACGCACCATTCGATCCTCTCACAAATACTTGGAAGCAAAGAAGCCGCAAATAGATCAATTTTGTATAGCTACAAGCATGGATTTTCCGGCTTTGCTGCAAATTTAACCCCGAC...

Protein

Download Protein FASTA

776 aa · TkA03G473150|TK1151|PROTEIN

MGFSSRVNVLLFLLVIFRQKWSVIGISRSKVHIVYMGHNTFAEPMIVQDTHHSILSQILGSKEAANRSILYSYKHGFSGFAANLTPTQASLIADLPGVVRVIPNRILKLHTTRSWDFLDVKPHLVDGIHSKGLSGVGSIIGVFDSGVWPESGSYHDVGMKKVPSRWKGVCEEGEHFNKSNCNRKIIGARWYIKGYEAEFGKLDTSDDSEFLSPRDAYGHGTHTSSTAAGAPITDTSFFGLAHGLTRGGAASSHIAIYKVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G473150`
TK1151 ID	TkA03G473150
OH-1004 ID	LXL04_009796
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G473150

Location Chr03:118279763-118285364 (+)

Description Similar to SBT3.9: Subtilisin-like protease SBT3.9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10520`	Subtilisin-like protease SBT3.9.	No verified direct reference in this release
`At4g10530`	Subtilisin-like protease SBT3.10.	No verified direct reference in this release
`At4g10550`	Subtilisin-like protease SBT3.6.	No verified direct reference in this release
`At4g10510`	Subtilisin-like protease SBT3.7.	No verified direct reference in this release
`At1g32940`	Serine protease that cleaves the pectin methylesterase 17 (PME17) protein to release the PME17 mature form in the apoplasm.	Arabidopsis PECTIN METHYLESTERASE17 is co-expressed with and processed by SBT3.5, a subtilisin-like serine protease.2014 · DOI: 10.1093/aob/mcu035

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10510

ath:AT4G10520

ath:AT4G10530

ath:AT4G10540

ath:AT4G10550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.557

Rank 1 · TkA03G473150 · TK1151

Lysosome / Vacuole0.129

Rank 2 · TkA03G473150 · TK1151

Cell membrane0.108

Rank 3 · TkA03G473150 · TK1151

Cytoplasm0.092

Rank 4 · TkA03G473150 · TK1151

Endoplasmic reticulum0.080

Rank 5 · TkA03G473150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922Inhibitor_I931-110 aa

PF21864MORF_dom49-108 aa

PF00082Peptidase_S8137-593 aa

PF21864MORF_dom254-263 aa

PF21864MORF_dom629-645 aa

PF17766fn3_6670-765 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G473150	`PF05922`	Inhibitor_I9	31	110	4.3e-18	66.5
TkA03G473150	`PF21864`	MORF_dom	49	108	1.1e-05	25.9
TkA03G473150	`PF00082`	Peptidase_S8	137	593	1.9e-42	146.3
TkA03G473150	`PF21864`	MORF_dom	254	263	1.1e-05	25.9
TkA03G473150	`PF21864`	MORF_dom	629	645	1.1e-05	25.9
TkA03G473150	`PF17766`	fn3_6	670	765	1.7e-25	89.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSB0`	Arabidopsis thaliana	sp\|Q9ZSB0\|SBT39_ARATH Subtilisin-like protease SBT3.9	47.500%	Swiss-Prot	Medium
`Q9ZSB1`	Arabidopsis thaliana	sp\|Q9ZSB1\|SBT3A_ARATH Subtilisin-like protease SBT3.10	46.400%	Swiss-Prot	Medium
`Q8L7I2`	Arabidopsis thaliana	sp\|Q8L7I2\|SBT36_ARATH Subtilisin-like protease SBT3.6	46.600%	Swiss-Prot	Medium
`Q9SZY2`	Arabidopsis thaliana	sp\|Q9SZY2\|SBT37_ARATH Subtilisin-like protease SBT3.7	47.600%	Swiss-Prot	Medium
`Q9MAP7`	Arabidopsis thaliana	sp\|Q9MAP7\|SBT35_ARATH Subtilisin-like protease SBT3.5	45.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card