TkA03G467460 | RubberDandelionOmics

Gene overview

TkA03G467460

Reference: TK1151 Chr: Chr03 Coordinates: 116715021-116717438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1514 bp · TkA03G467460|TK1151|cDNA

ACGTGATACGATCAACCATCCGAGGCAAAAGGATCACCATCTTGAGCAGAGCCTCAATCAAGTGAAGGTCGTTTTGAGCGACAAAAGTTGCCCCGAAGATGCATTCTCGATTCAAATCTCTATCTCGAACCCTAATCAATTCCAATCTCCTTTCTTCAATCTCAGTTCGAACCTTCTCTTCTCAAATCCAAAACCCACAAACCCTAACCGAGCTCCGCCACCGTCTCGCCGCCGAATCACCTACCTTAAACGACTTCATC...

CDS

Download CDS FASTA

903 bp · TkA03G467460|TK1151|CDS

ATGCATTCTCGATTCAAATCTCTATCTCGAACCCTAATCAATTCCAATCTCCTTTCTTCAATCTCAGTTCGAACCTTCTCTTCTCAAATCCAAAACCCACAAACCCTAACCGAGCTCCGCCACCGTCTCGCCGCCGAATCACCTACCTTAAACGACTTCATCCGTCTCCGATCCGAAGAAGAGTATTCTGTCGAGGTCGGAACGAAGAAGAAGCCCTTACCTAAGCCTAAATGGATGAAGGAATCGATCCCCGGTGGGGA...

Protein

Download Protein FASTA

300 aa · TkA03G467460|TK1151|PROTEIN

MHSRFKSLSRTLINSNLLSSISVRTFSSQIQNPQTLTELRHRLAAESPTLNDFIRLRSEEEYSVEVGTKKKPLPKPKWMKESIPGGEKYTHIKKKLRELKLHTVCEEAKCPNLGECWSGGETGTATATIMILGDTCTRGCRFCNVKTSRTPPPPDPNEPSNVAEAIASWGLDYVVITSVDRDDLSDQGSGHFAETVQKLKTLKPSILIEALVPDFRGDVSCVEKVSKSGLDVFAHNIETVEELQSSVRDHRANFKQSLGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G467460`
TK1151 ID	TkA03G467460
OH-1004 ID	LXL04_009742
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.667 / OH-1004 73.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G467460`
Location	Chr03:116715021-116717438 (-)
Description	Similar to LIP1: Lipoyl synthase, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009742` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009107 lipoate biosynthetic process Biological Process GO:0009249 protein lipoylation Biological Process GO:0005739 mitochondrion Cellular Component GO:0016992 lipoate synthase activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function
KEGG gene cross-reference	pop:7486347 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.831

Rank 1 · TkA03G467460 · TK1151

Cytoplasm0.103

Rank 2 · TkA03G467460 · TK1151

Plastid0.094

Rank 3 · TkA03G467460 · TK1151

Nucleus0.065

Rank 4 · TkA03G467460 · TK1151

Peroxisome0.022

Rank 5 · TkA03G467460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16881LIAS_N26-110 aa

PF11029DAZAP2126-172 aa

PF04055Radical_SAM130-285 aa

PF11029DAZAP2275-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G467460	`PF16881`	LIAS_N	26	110	2.7e-17	63.7
TkA03G467460	`PF11029`	DAZAP2	126	172	0.28	12.8
TkA03G467460	`PF04055`	Radical_SAM	130	285	2.7e-16	60.9
TkA03G467460	`PF11029`	DAZAP2	275	286	0.28	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card