TkA03G421100 | RubberDandelionOmics

Gene overview

TkA03G421100

Reference: TK1151 Chr: Chr03 Coordinates: 104859250-104862368 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1029 bp · TkA03G421100|TK1151|cDNA

AATCTTAGTCGAGCCGAGCTCGAGAGACTCGGATATTTCACGAGCTTGAGCTTGAAATTGAGGCTCGTGGCAAGCTTGAGCCGAGCTTCGAGCTCGAGCATGAAACCTAGGGAGTATTGTTGGTTGATTCTAGAGCACTGTGTTGGAGTTGATCTTCGTACATTACTGGAGCAGTGCAGTAAACTTCCAGTAGATTCAGTATCTGATCTTGCAAACGATCTTGTCAGTGGTTTAAGATATTTACACTCGAAGGGAATCAT...

CDS

Download CDS FASTA

1029 bp · TkA03G421100|TK1151|CDS

AATCTTAGTCGAGCCGAGCTCGAGAGACTCGGATATTTCACGAGCTTGAGCTTGAAATTGAGGCTCGTGGCAAGCTTGAGCCGAGCTTCGAGCTCGAGCATGAAACCTAGGGAGTATTGTTGGTTGATTCTAGAGCACTGTGTTGGAGTTGATCTTCGTACATTACTGGAGCAGTGCAGTAAACTTCCAGTAGATTCAGTATCTGATCTTGCAAACGATCTTGTCAGTGGTTTAAGATATTTACACTCGAAGGGAATCAT...

Protein

Download Protein FASTA

342 aa · TkA03G421100|TK1151|PROTEIN

NLSRAELERLGYFTSLSLKLRLVASLSRASSSSMKPREYCWLILEHCVGVDLRTLLEQCSKLPVDSVSDLANDLVSGLRYLHSKGIIHSDLKLSNILWDGNGRSKLCDFGLSKELSDISKTPSSLVGEGHKRGSPFYMVLELFYDGGVHSYASDFELRKEKLDVAIELIVSILDKRETSISIKQGVVRFMHPLSTNLNAANIFLNDSIMWTLVKMLRQCTVPYTLVSLVTSLVSLVTSFLREGDDEITQLYALKTIDNIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G421100`
TK1151 ID	TkA03G421100
OH-1004 ID	LXL04_005959
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	27.500
Protein coverage (%)	TK1151 88.596 / OH-1004 65.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G421100

Location Chr03:104859250-104862368 (+)

Description Similar to RUK: Serine/threonine-protein kinase RUNKEL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18700`	Essential protein that regulates phragmoplast microtubule organization during cell plate expansion in cytokinesis during cell division, both somatic and syncytial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005959 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0000914 phragmoplast assembly Biological Process

GO:0003351 epithelial cilium movement involved in extracellular fluid movement Biological Process

GO:0007224 smoothened signaling pathway Biological Process

GO:0007349 cellularization Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0010245 radial microtubular system formation Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010467 gene expression Biological Process

KEGG gene cross-reference

ath:AT5G18700

hsa:54986

mmu:209012

pon:100173957

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.439

Rank 1 · TkA03G421100 · TK1151

Cytoplasm0.414

Rank 2 · TkA03G421100 · TK1151

Endoplasmic reticulum0.098

Rank 3 · TkA03G421100 · TK1151

Cell membrane0.093

Rank 4 · TkA03G421100 · TK1151

Mitochondrion0.070

Rank 5 · TkA03G421100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase33-142 aa

PF07714PK_Tyr_Ser-Thr37-146 aa

PF03109ABC142-118 aa

PF06293Kdo50-109 aa

PF07387Seadorna_VP755-109 aa

PF01636APH83-103 aa

PF24768ARM_ARMC5165-266 aa

PF07387Seadorna_VP7193-225 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G421100	`PF00069`	Pkinase	33	142	1.3e-21	78.0
TkA03G421100	`PF07714`	PK_Tyr_Ser-Thr	37	146	1.3e-14	54.9
TkA03G421100	`PF03109`	ABC1	42	118	7.7e-05	22.7
TkA03G421100	`PF06293`	Kdo	50	109	0.14	12.3
TkA03G421100	`PF07387`	Seadorna_VP7	55	109	0.028	14.2
TkA03G421100	`PF01636`	APH	83	103	0.11	12.9
TkA03G421100	`PF24768`	ARM_ARMC5	165	266	0.0025	18.0
TkA03G421100	`PF07387`	Seadorna_VP7	193	225	0.028	14.2
TkA03G421100	`PF07714`	PK_Tyr_Ser-Thr	211	254	1.3e-14	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JY37`	Arabidopsis thaliana	sp\|F4JY37\|RUK_ARATH Serine/threonine-protein kinase RUNKEL	62.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card