TkA03G405550 | RubberDandelionOmics

Gene overview

TkA03G405550

Reference: TK1151 Chr: Chr03 Coordinates: 100852173-100852655 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA03G405550|TK1151|cDNA

ATGGCTTCTTCGAAAGGACCCGACCCGGTTTCTAACTTGAAACCGCAACCCTCCACCACATTCGTGCAAGCGGACCCTTCTAACTTCCGGGCCGTCGTCCAAAAACTCACCGGAGACACCACCCACAAACTCCGAAACTCGACCCCCTTCCGCCACGCCGGAAAACCCACCGTTACTGAAGTTGTTCGTGGGAGATCCGGTTATAAGCTTCAAGAACGGAGAAAAACTGGTAAGAAACTGGAGATCACTCTCGGAAAAGT...

CDS

Download CDS FASTA

483 bp · TkA03G405550|TK1151|CDS

ATGGCTTCTTCGAAAGGACCCGACCCGGTTTCTAACTTGAAACCGCAACCCTCCACCACATTCGTGCAAGCGGACCCTTCTAACTTCCGGGCCGTCGTCCAAAAACTCACCGGAGACACCACCCACAAACTCCGAAACTCGACCCCCTTCCGCCACGCCGGAAAACCCACCGTTACTGAAGTTGTTCGTGGGAGATCCGGTTATAAGCTTCAAGAACGGAGAAAAACTGGTAAGAAACTGGAGATCACTCTCGGAAAAGT...

Protein

Download Protein FASTA

160 aa · TkA03G405550|TK1151|PROTEIN

MASSKGPDPVSNLKPQPSTTFVQADPSNFRAVVQKLTGDTTHKLRNSTPFRHAGKPTVTEVVRGRSGYKLQERRKTGKKLEITLGKVSQVGEMVEASPVSTLAVCGRGSPGTPVEGEEEEEKAIAEKGFYLHPSPVTEPKPELLVLFPLKSPRMDPSYSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G405550`
TK1151 ID	TkA03G405550
OH-1004 ID	LXL04_009177
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 85.000 / OH-1004 97.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G405550

Location Chr03:100852173-100852655 (-)

Description Similar to VQ11: VQ motif-containing protein 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80450`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At5g08480`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At3g15300`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At1g28280`	Acts as a negative regulator of WRKY33 transcription factor activity in the promotion of defense gene expression.	The Arabidopsis thaliana mitogen-activated protein kinases MPK3 and MPK6 target a subclass of 'VQ-motif'-containing proteins to regulate immune responses.2014 · DOI: 10.1111/nph.12817
`At5g53830`	May modulate WRKY transcription factor activities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009177 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051245 negative regulation of cellular defense response Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G28280

ath:AT1G80450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.763

Rank 1 · TkA03G405550 · TK1151

Cytoplasm0.359

Rank 2 · TkA03G405550 · TK1151

Cell membrane0.062

Rank 3 · TkA03G405550 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA03G405550 · TK1151

Plastid0.014

Rank 5 · TkA03G405550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05678VQ17-38 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G405550	`PF05678`	VQ	17	38	5e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8L3`	Arabidopsis thaliana	sp\|Q9M8L3\|VQ11_ARATH VQ motif-containing protein 11	41.300%	Swiss-Prot	Medium
`Q9FNP0`	Arabidopsis thaliana	sp\|Q9FNP0\|VQ31_ARATH VQ motif-containing protein 31	39.200%	Swiss-Prot	Medium
`Q9LDZ1`	Arabidopsis thaliana	sp\|Q9LDZ1\|VQ19_ARATH VQ motif-containing protein 19	33.700%	Swiss-Prot	Medium
`Q5M750`	Arabidopsis thaliana	sp\|Q5M750\|VQ4_ARATH VQ motif-containing protein 4	33.200%	Swiss-Prot	Medium
`Q9FHZ3`	Arabidopsis thaliana	sp\|Q9FHZ3\|VQ33_ARATH VQ motif-containing protein 33	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card