RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G364720
Reference: TK1151 Chr: Chr03 Coordinates: 89973571-89986259 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4535 bp · TkA03G364720|TK1151|cDNA

GCTTTATATATGTAAGCATATATATATATTTATAATTATCTCATCTCCCCTTTAAGATTCTTTTGATTTCATTTGTGCTTACAGTCCCTTTTTTCATCTCAAGTTTGAGCAACATACATGTCGATTCTACAAGAACTTGATCACCTTAGAATTCCACTTGAAGACATAAAACAGGCAACCAACAATTTTTCTCGTGAAAGTATCAAAGGACGGGGCAGTGCTTACGGGATGGTGTATACCGGAGTGCTTTTACACGTAAA...

CDS

Download CDS FASTA

4179 bp · TkA03G364720|TK1151|CDS

ATGTCGATTCTACAAGAACTTGATCACCTTAGAATTCCACTTGAAGACATAAAACAGGCAACCAACAATTTTTCTCGTGAAAGTATCAAAGGACGGGGCAGTGCTTACGGGATGGTGTATACCGGAGTGCTTTTACACGTAAATGGGCCTACTAAGATTGTAGCAAGGCGAGTCGATCCGAGCGCAAGTCAGGAAGCAAAGTATTTTTTAAACGAGATCAGAGTCCTTACTTTATACAAACATGTTAATATTGTCTCATT...

Protein

Download Protein FASTA

1392 aa · TkA03G364720|TK1151|PROTEIN

MSILQELDHLRIPLEDIKQATNNFSRESIKGRGSAYGMVYTGVLLHVNGPTKIVARRVDPSASQEAKYFLNEIRVLTLYKHVNIVSFMGFCDENDEKIFVQEYESYAGLDRVLSNSKLKWLQRLQICLGAARGLNHLHNGVEGHTVIHHHICSRSIILDKIRWQSKIARLSYSILDHEMHHTIDQGIVGKTAYIDPTFLQTGIVTKESDIYSFGVVLFEVLCGRLAYELKENEEQYLGPLATLHYEAGKLDEIIDPLLRI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G364720
TK1151 IDTkA03G364720
OH-1004 IDLXL04_008501
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G364720
LocationChr03:89973571-89986259 (-)
DescriptionSimilar to HERK1: Receptor-like protein kinase HERK 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release
At5g38990 Probable receptor-like protein kinase At5g38990. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008501 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009741 response to brassinosteroid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009536 plastid Cellular Component
GO:0043680 filiform apparatus Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G46290
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.534
Rank 1 · TkA03G364720 · TK1151
Cell membrane0.314
Rank 2 · TkA03G364720 · TK1151
Nucleus0.290
Rank 3 · TkA03G364720 · TK1151
Endoplasmic reticulum0.053
Rank 4 · TkA03G364720 · TK1151
Lysosome / Vacuole0.044
Rank 5 · TkA03G364720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase31-294 aa
PF07714PK_Tyr_Ser-Thr35-295 aa
PF02847MA3247-324 aa
PF00069Pkinase336-350 aa
PF07714PK_Tyr_Ser-Thr339-644 aa
PF00069Pkinase379-642 aa
PF01636APH449-513 aa
PF07714PK_Tyr_Ser-Thr680-941 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G364720PF00069Pkinase312946.6e-79265.7
TkA03G364720PF07714PK_Tyr_Ser-Thr352951.7e-102342.9
TkA03G364720PF02847MA32473240.04114.6
TkA03G364720PF00069Pkinase3363506.6e-79265.7
TkA03G364720PF07714PK_Tyr_Ser-Thr3396441.7e-102342.9
TkA03G364720PF00069Pkinase3796426.6e-79265.7
TkA03G364720PF01636APH4495130.001918.7
TkA03G364720PF07714PK_Tyr_Ser-Thr6809411.7e-102342.9
TkA03G364720PF00069Pkinase6919396.6e-79265.7
TkA03G364720PF01636APH7828130.001918.7
TkA03G364720PF14299PP2101911245.7e-32111.5
TkA03G364720PF00069Pkinase116412076.6e-79265.7
TkA03G364720PF14299PP2122813915.7e-32111.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FID8Arabidopsis thalianasp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g3900039.800%Swiss-ProtLow
Q9FID9Arabidopsis thalianasp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g3899039.500%Swiss-ProtLow
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 139.100%Swiss-ProtLow
O80623Arabidopsis thalianasp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g3936039.000%Swiss-ProtLow
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970038.500%Swiss-ProtLow

JBrowse

View in Genome Browser