TkA03G284860 | RubberDandelionOmics

Gene overview

TkA03G284860

Reference: TK1151 Chr: Chr03 Coordinates: 70301291-70306446 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

946 bp · TkA03G284860|TK1151|cDNA

TTCCCTCATTTCAATAAAGCATTATTTATATATTACACTTTACCTTCCCTCTCTCTCATATCTCTAAACTTCCACCTCCAATTTCAATTCTCTCAACTCAGAGCATCCAATTCAAAAAACACACAAATGAAGAAATTTATATTGAAGTTAGACTTGAATGATGAAAAGGACAAGAGGAAAGCTATGAAAACTGTTGCAGCATTTGCAGGGATAGACTCAATCACCATAAACATGAAAGAGAAGAATTTGACAATCGTTGG...

CDS

Download CDS FASTA

684 bp · TkA03G284860|TK1151|CDS

TTCCCTCATTTCAATAAAGCATTATTTATATATTACACTTTACCTTCCCTCTCTCTCATATCTCTAAACTTCCACCTCCAATTTCAATTCTCTCAACTCAGAGCATCCAATTCAAAAAACACACAAATGAAGAAATTTATATTGAAGTTAGACTTGAATGATGAAAAGGACAAGAGGAAAGCTATGAAAACTGTTGCAGCATTTGCAGGGATAGACTCAATCACCATAAACATGAAAGAGAAGAATTTGACAATCGTTGG...

Protein

Download Protein FASTA

227 aa · TkA03G284860|TK1151|PROTEIN

FPHFNKALFIYYTLPSLSLISLNFHLQFQFSQLRASNSKNTQMKKFILKLDLNDEKDKRKAMKTVAAFAGIDSITINMKEKNLTIVGTADPISAVSKLRKQWPTYLVSVGPAKEPEPEKKEEPKKEEEKKDDTKPEEKKEEPKKEEPKKEEEAPKEGEAPKEGEAPKEEPKKEEPKEEEAKKSVPQEQLVGTLMPYKPYYPPMHTYYNYQPPLHHSIEENPNACVIC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G284860`
TK1151 ID	TkA03G284860
OH-1004 ID	LXL04_005519
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.400
Protein coverage (%)	TK1151 33.921 / OH-1004 15.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G284860

Location Chr03:70301291-70306446 (-)

Description Similar to HIPP39: Heavy metal-associated isoprenylated plant protein 39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01490`	Probable heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005519 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01490

ath:AT5G52740

ath:AT5G52760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA03G284860 · TK1151

Cell membrane0.321

Rank 2 · TkA03G284860 · TK1151

Nucleus0.274

Rank 3 · TkA03G284860 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA03G284860 · TK1151

Mitochondrion0.054

Rank 5 · TkA03G284860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11754Velvet34-193 aa

PF19268CIS_TMP47-173 aa

PF06459RR_TM4-650-180 aa

PF00403HMA58-100 aa

PF06012DUF90863-178 aa

PF02535Zip89-175 aa

PF02862DDHD112-189 aa

PF28211GlpR113-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G284860	`PF11754`	Velvet	34	193	0.13	13.0
TkA03G284860	`PF19268`	CIS_TMP	47	173	0.8	9.6
TkA03G284860	`PF06459`	RR_TM4-6	50	180	0.34	11.4
TkA03G284860	`PF00403`	HMA	58	100	3e-05	25.0
TkA03G284860	`PF06012`	DUF908	63	178	9.4	6.3
TkA03G284860	`PF02535`	Zip	89	175	0.67	9.8
TkA03G284860	`PF02862`	DDHD	112	189	0.89	10.4
TkA03G284860	`PF28211`	GlpR	113	179	0.088	13.6
TkA03G284860	`PF02724`	CDC45	118	181	0.15	11.1
TkA03G284860	`PF03666`	NPR3	118	182	0.97	8.9
TkA03G284860	`PF01080`	Presenilin	119	176	3.1	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O03982`	Arabidopsis thaliana	sp\|O03982\|HIP39_ARATH Heavy metal-associated isoprenylated plant protein 39	65.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card