TkA03G240130 | RubberDandelionOmics

Gene overview

TkA03G240130

Reference: TK1151 Chr: Chr03 Coordinates: 59769916-59773296 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

999 bp · TkA03G240130|TK1151|cDNA

ATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGTCACTTACAATTGACGTATCTACCGTCAGGATGGTAGCTAACCATCGGTTTAATAAGCCTAGTGATCATGGTCAACTCCGTGATGGTGAGACTCAAACAAGAGCTAGTCACAGAATCTCTCACGATCCTAAGGATTACGC...

CDS

Download CDS FASTA

999 bp · TkA03G240130|TK1151|CDS

ATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGCATCAACGCCCTATTCCATGCGTTATGCTAGTGTTGTCACTTACAATTGACGTATCTACCGTCAGGATGGTAGCTAACCATCGGTTTAATAAGCCTAGTGATCATGGTCAACTCCGTGATGGTGAGACTCAAACAAGAGCTAGTCACAGAATCTCTCACGATCCTAAGGATTACGC...

Protein

Download Protein FASTA

332 aa · TkA03G240130|TK1151|PROTEIN

MLVLHQRPIPCVMLVLHQRPIPCVMLVLHQRPIPCVMLVLSLTIDVSTVRMVANHRFNKPSDHGQLRDGETQTRASHRISHDPKDYAALGVCNCSVFTSVEQQPSLRAAVRGGCAASDPFSGVIRSNSWSGFGRGRQRERVVCSDPKEVAGFVGFEGGGVPRPSATVTPIWAVSGGVLRTETCVVVSWLYGEDVVKVWERSEPRKEEKPVAVSAKDETIATAGASLQTSANRFHLNLSCLVVPLVRPGTIDSCPSHVLLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G240130`
TK1151 ID	TkA03G240130
OH-1004 ID	LXL04_007242
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 28.916 / OH-1004 10.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G240130`
Location	Chr03:59769916-59773296 (-)
Description	Similar to ISPH: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007242` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process GO:0050992 dimethylallyl diphosphate biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0046429 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity (ferredoxin) Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function GO:0051745 4-hydroxy-3-methylbut-2-enyl diphosphate reductase activity Molecular Function
KEGG gene cross-reference	ath:AT4G34350 dosa:Os03g0731900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.381

Rank 1 · TkA03G240130 · TK1151

Nucleus0.320

Rank 2 · TkA03G240130 · TK1151

Cell membrane0.166

Rank 3 · TkA03G240130 · TK1151

Mitochondrion0.155

Rank 4 · TkA03G240130 · TK1151

Endoplasmic reticulum0.104

Rank 5 · TkA03G240130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03657UPF0113188-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G240130	`PF03657`	UPF0113	188	229	0.15	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card