TkA03G118710 | RubberDandelionOmics

Gene overview

TkA03G118710

Reference: TK1151 Chr: Chr03 Coordinates: 30333653-30335513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1445 bp · TkA03G118710|TK1151|cDNA

GAAAATGAGTGGATACATTCCATTCCCGTCTTTGACAAGTTAACTGGTGGAATACCGTCTCCCGATTCCGGAATCGATTCAATCACCAAATCCGGTCCTTAATGAAACTGGAAGATTAGAATTAGGAATCCGATTCCGCCTCGTCTCCACCATCCCTAATCCGTCGATATCCTCCGGCGACAACCGTGGAAGCCTCGCTTTTCTTCACACAGCCTGCTGAAATTAGGAATGGGTAGAGTATCTGAACGAGGTACCAAAAT...

CDS

Download CDS FASTA

981 bp · TkA03G118710|TK1151|CDS

ATGGGTAGAGTATCTGAACGAGGTACCAAAATCAAAAAACACAAATGGACAAAAAGAGAAGACGAAGCACTGATATCTGCACTCACAGAGCTATGTCAAACCGGTTGGAAAAGAGACAACAACATCTTCAGAAGTGGATACACAACTGTCCTTGAGAAAGAACTGAAATCAAAGCTTCCTGGATGCAATCTCAAAGCCAGTCCCCACATCGAATCCAGGCTCAAAACTTTAAAAAAACACTGCGATGCAATTACAGATAT...

Protein

Download Protein FASTA

326 aa · TkA03G118710|TK1151|PROTEIN

MGRVSERGTKIKKHKWTKREDEALISALTELCQTGWKRDNNIFRSGYTTVLEKELKSKLPGCNLKASPHIESRLKTLKKHCDAITDMKDAFGIEWKSSDSTLTCYDDDVWEDWVKDHSDAKGLRNKPFPYYDELCMIFGKTRGNNHKPGEDSSNGKRALAVYEGSELGFDPEKVVETKHESDHEDGNNHDHDGDDDDDDNDEDEDDDDVMVTPEVGIKKKSGGQGSGSCTSGMEMGKVFEALMKRNEEQFGILAGIVGRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G118710`
TK1151 ID	TkA03G118710
OH-1004 ID	LXL04_025808
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.165 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G118710`
Location	Chr03:30333653-30335513 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025808` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT2G29880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA03G118710 · TK1151

Cytoplasm0.086

Rank 2 · TkA03G118710 · TK1151

Cell membrane0.020

Rank 3 · TkA03G118710 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA03G118710 · TK1151

Extracellular0.010

Rank 5 · TkA03G118710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_413-85 aa

PF12776Myb_DNA-bind_315-112 aa

PF21150YebU_pre-PUA_dom34-43 aa

PF21150YebU_pre-PUA_dom78-110 aa

PF13837Myb_DNA-bind_4124-136 aa

PF06524NOA36139-207 aa

PF04889Cwf_Cwc_15153-207 aa

PF03153TFIIA155-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G118710	`PF13837`	Myb_DNA-bind_4	13	85	0.33	12.1
TkA03G118710	`PF12776`	Myb_DNA-bind_3	15	112	2.9e-07	32.0
TkA03G118710	`PF21150`	YebU_pre-PUA_dom	34	43	0.55	10.9
TkA03G118710	`PF21150`	YebU_pre-PUA_dom	78	110	0.55	10.9
TkA03G118710	`PF13837`	Myb_DNA-bind_4	124	136	0.33	12.1
TkA03G118710	`PF06524`	NOA36	139	207	0.66	10.0
TkA03G118710	`PF04889`	Cwf_Cwc_15	153	207	0.17	12.4
TkA03G118710	`PF03153`	TFIIA	155	211	7.4	7.1
TkA03G118710	`PF04147`	Nop14	161	209	9.2	5.1
TkA03G118710	`PF17110`	TFB6	175	243	1.9	9.0
TkA03G118710	`PF05642`	Sporozoite_P67	178	233	1.2	7.9
TkA03G118710	`PF10446`	DUF2457	178	208	5.7	6.7
TkA03G118710	`PF24769`	At2g29880_C	278	319	0.00012	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card