TkA03G035540 | RubberDandelionOmics

Gene overview

TkA03G035540

Reference: TK1151 Chr: Chr03 Coordinates: 9373437-9374627 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1012 bp · TkA03G035540|TK1151|cDNA

TTATTTTTCATGCCAATGTTTTCCTCAAGCCCTTTTCCCGAGCTTCCGTCATCCCCCAATAATGTCTTCTTTCCACCCAATTTTCTCTTTCACCATGAAAATGATAGTGCTTGCTTTAACTACCACCTGAACAACAGCGACCCACTAATCTCCGGTGACTTTTTTCATGATATATATACCAACAACAATCTTGCTCCTCCTTCTCCGGTCATACCTACCACTTCTACAATCGAAGAAGAACTAGGGTTGCAGTCTTATGA...

CDS

Download CDS FASTA

846 bp · TkA03G035540|TK1151|CDS

ATGCCAATGTTTTCCTCAAGCCCTTTTCCCGAGCTTCCGTCATCCCCCAATAATGTCTTCTTTCCACCCAATTTTCTCTTTCACCATGAAAATGATAGTGCTTGCTTTAACTACCACCTGAACAACAGCGACCCACTAATCTCCGGTGACTTTTTTCATGATATATATACCAACAACAATCTTGCTCCTCCTTCTCCGGTCATACCTACCACTTCTACAATCGAAGAAGAACTAGGGTTGCAGTCTTATGAAGATCATGA...

Protein

Download Protein FASTA

281 aa · TkA03G035540|TK1151|PROTEIN

MPMFSSSPFPELPSSPNNVFFPPNFLFHHENDSACFNYHLNNSDPLISGDFFHDIYTNNNLAPPSPVIPTTSTIEEELGLQSYEDHDDLLESVIASCKKKTVVSKKNGHSKIYTARGLRDRRVRLSIDISRKFFCLQDLLGFDKASKTLDWLFGKCMTAIEELVRETNRCPSSTTTYESKESFLEAIMGGDDERKSKKETQVKYGDGKRKKIAQNPTSGFQDNLPKDQSRAVARARARERVREKMRIRNLDDEFKTLTDH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G035540`
TK1151 ID	TkA03G035540
OH-1004 ID	LXL04_006423
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 92.527 / OH-1004 93.190 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G035540

Location Chr03:9373437-9374627 (-)

Description Similar to TB1: Transcription factor TEOSINTE BRANCHED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67260`	Involved in petal morphogenesis.	Control of corolla monosymmetry in the Brassicaceae Iberis amara.2007 · DOI: 10.1073/pnas.0705338104

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006423 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009908 flower development Biological Process

GO:0048262 determination of dorsal/ventral asymmetry Biological Process

GO:0048831 regulation of shoot system development Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G67260

dosa:Os03g0706500

osa:4333856

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA03G035540 · TK1151

Cytoplasm0.106

Rank 2 · TkA03G035540 · TK1151

Cell membrane0.026

Rank 3 · TkA03G035540 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA03G035540 · TK1151

Plastid0.012

Rank 5 · TkA03G035540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21648M1E1E6-like31-66 aa

PF03634TCP104-246 aa

PF15343DEPP114-171 aa

PF15343DEPP216-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G035540	`PF21648`	M1E1E6-like	31	66	0.082	13.8
TkA03G035540	`PF03634`	TCP	104	246	3.1e-36	126.0
TkA03G035540	`PF15343`	DEPP	114	171	0.024	15.5
TkA03G035540	`PF15343`	DEPP	216	254	0.024	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYG7`	Arabidopsis thaliana	sp\|Q9FYG7\|TCP1_ARATH Transcription factor TCP1	68.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card