TkA03G033640 | RubberDandelionOmics

Gene overview

TkA03G033640

Reference: TK1151 Chr: Chr03 Coordinates: 8913112-8913628 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · TkA03G033640|TK1151|cDNA

ATGACTCTCGACGCCGCCTACCTCCGTGGATCCATGGCCGCCATTCTTTCCGTCCTTCAACACTCTTCCTGCCCATTCAACGTCTACAGATTCGACGACCCCGCCGTGTTGGGACTCATCTCCACCTCCATTCGCTCCGCCCTCGACTGCCCACTCAACTATGCTCGAAACTACCTCGCCGACCTCCTCCCTACCTGCGTCAACAAAGTCGTGAATACTGCAACGCGAACTTCACATCCTACTTTACCCCGACGTTTTGG...

CDS

Download CDS FASTA

330 bp · TkA03G033640|TK1151|CDS

ATGACTCTCGACGCCGCCTACCTCCGTGGATCCATGGCCGCCATTCTTTCCGTCCTTCAACACTCTTCCTGCCCATTCAACGTCTACAGATTCGACGACCCCGCCGTGTTGGGACTCATCTCCACCTCCATTCGCTCCGCCCTCGACTGCCCACTCAACTATGCTCGAAACTACCTCGCCGACCTCCTCCCTACCTGCGTCAACAAAGTCGTGAATACTGCAACGCGAACTTCACATCCTACTTTACCCCGACGTTTTGG...

Protein

Download Protein FASTA

109 aa · TkA03G033640|TK1151|PROTEIN

MTLDAAYLRGSMAAILSVLQHSSCPFNVYRFDDPAVLGLISTSIRSALDCPLNYARNYLADLLPTCVNKVVNTATRTSHPTLPRRFGQTHLSPPHSPTETHVISTPELW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G033640`
TK1151 ID	TkA03G033640
OH-1004 ID	LXL04_006403
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.300
Protein coverage (%)	TK1151 65.138 / OH-1004 28.940 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G033640

Location Chr03:8913112-8913628 (-)

Description Similar to GATL2: Probable galacturonosyltransferase-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50760`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g19300`	May participate in biosynthesis of the reducing-end tetrasaccharide primer of glucuronoxylan.	Mutation of a family 8 glycosyltransferase gene alters cell wall carbohydrate composition and causes a humidity-sensitive semi-sterile dwarf phenotype in Arabidopsis.2003 · DOI: 10.1023/b:plan.0000019074.60542.6c The GAOLAOZHUANGREN1 gene encodes a putative glycosyltransferase that is critical for normal development and carbohydrate metabolism.2004 · DOI: 10.1093/pcp/pch168 The PARVUS gene is expressed in cells undergoing secondary wall thickening and is essential for glucuronoxylan biosynthesis.2007 · DOI: 10.1093/pcp/pcm155
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g28340`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010417 glucuronoxylan biosynthetic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0048366 leaf development Biological Process

GO:0052386 cell wall thickening Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G19300

ath:AT3G06260

ath:AT3G50760

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.395

Rank 1 · TkA03G033640 · TK1151

Nucleus0.362

Rank 2 · TkA03G033640 · TK1151

Mitochondrion0.179

Rank 3 · TkA03G033640 · TK1151

Cell membrane0.086

Rank 4 · TkA03G033640 · TK1151

Endoplasmic reticulum0.081

Rank 5 · TkA03G033640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_81-32 aa

PF01501Glyco_transf_851-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G033640	`PF01501`	Glyco_transf_8	1	32	0.00095	19.5
TkA03G033640	`PF01501`	Glyco_transf_8	51	71	0.00095	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7G2`	Arabidopsis thaliana	sp\|Q9S7G2\|GATL2_ARATH Probable galacturonosyltransferase-like 2	56.600%	Swiss-Prot	Medium
`Q9LN68`	Arabidopsis thaliana	sp\|Q9LN68\|GATL1_ARATH Probable galacturonosyltransferase-like 1	54.500%	Swiss-Prot	Medium
`O04253`	Arabidopsis thaliana	sp\|O04253\|GATL6_ARATH Probable galacturonosyltransferase-like 6	46.500%	Swiss-Prot	Medium
`Q8VYF4`	Arabidopsis thaliana	sp\|Q8VYF4\|GATL7_ARATH Probable galacturonosyltransferase-like 7	47.900%	Swiss-Prot	Medium
`Q9LHD2`	Arabidopsis thaliana	sp\|Q9LHD2\|GATLA_ARATH Probable galacturonosyltransferase-like 10	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card