TkA02G550800 | RubberDandelionOmics

Gene overview

TkA02G550800

Reference: TK1151 Chr: Chr02 Coordinates: 142102168-142103357 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

582 bp · TkA02G550800|TK1151|cDNA

ATGCCGGCCAACAAGGTCGTCTTCGGCCACCACATTCGTATTGCTGTGTGTAGTTTTTTGAGCTTGTACAATCGACTAGGTGTAGAGAGACGACGAATTTACGATATTGTCAAAGTTCTTTTGAAAAAAGCAAAAAATACGTACTACTGGAAAGGACTTGGAGCAATTCCTACGACATTAGAGCAGCTAAAGGAAGAAGGTTTCACGAATAATGATGAACCAATTGATTGTAAACCTGGAAAAGTAGAAGACGATGAAGA...

CDS

Download CDS FASTA

582 bp · TkA02G550800|TK1151|CDS

ATGCCGGCCAACAAGGTCGTCTTCGGCCACCACATTCGTATTGCTGTGTGTAGTTTTTTGAGCTTGTACAATCGACTAGGTGTAGAGAGACGACGAATTTACGATATTGTCAAAGTTCTTTTGAAAAAAGCAAAAAATACGTACTACTGGAAAGGACTTGGAGCAATTCCTACGACATTAGAGCAGCTAAAGGAAGAAGGTTTCACGAATAATGATGAACCAATTGATTGTAAACCTGGAAAAGTAGAAGACGATGAAGA...

Protein

Download Protein FASTA

193 aa · TkA02G550800|TK1151|PROTEIN

MPANKVVFGHHIRIAVCSFLSLYNRLGVERRRIYDIVKVLLKKAKNTYYWKGLGAIPTTLEQLKEEGFTNNDEPIDCKPGKVEDDEDERFSNCSVSFQEKVDPDSTHKSLGLFKSDNRKEKSIGLLTTNFLKLFICTHSDTLSFEDAAKILLGDARNPSLTRTKVRRLYDIVNVLSSMNFIEKIHHPETENLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G550800`
TK1151 ID	TkA02G550800
OH-1004 ID	LXL04_000137
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 81.347 / OH-1004 99.367 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G550800

Location Chr02:142102168-142103357 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48160`	Inhibitor of E2F-dependent activation of gene expression.	E2Ls, E2F-like repressors of Arabidopsis that bind to E2F sites in a monomeric form.2002 · DOI: 10.1074/jbc.m200913200 The DP-E2F-like gene DEL1 controls the endocycle in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2004.12.038 Atypical E2F activity restrains APC/CCCS52A2 function obligatory for endocycle onset.2008 · DOI: 10.1073/pnas.0806510105
`At3g01330`	Inhibitor of E2F-dependent activation of gene expression.	E2Ls, E2F-like repressors of Arabidopsis that bind to E2F sites in a monomeric form.2002 · DOI: 10.1074/jbc.m200913200 Role of an atypical E2F transcription factor in the control of Arabidopsis cell growth and differentiation.2004 · DOI: 10.1105/tpc.104.023978
`At5g14960`	Inhibitor of E2F-dependent regulation of gene expression.	E2Ls, E2F-like repressors of Arabidopsis that bind to E2F sites in a monomeric form.2002 · DOI: 10.1074/jbc.m200913200 The E2FD/DEL2 factor is a component of a regulatory network controlling cell proliferation and development in Arabidopsis.2010 · DOI: 10.1007/s11103-009-9577-8

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000137 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009733 response to auxin Biological Process

GO:0032466 negative regulation of cytokinesis Biological Process

GO:0032876 negative regulation of DNA endoreduplication Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000134 negative regulation of G1/S transition of mitotic cell cycle Biological Process

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ath:AT3G01330

ath:AT3G48160

ath:AT5G14960

hsa:144455

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.761

Rank 1 · TkA02G550800 · TK1151

Cytoplasm0.320

Rank 2 · TkA02G550800 · TK1151

Mitochondrion0.041

Rank 3 · TkA02G550800 · TK1151

Cell membrane0.026

Rank 4 · TkA02G550800 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA02G550800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02319WHD_E2F_TDP21-52 aa

PF01978TrmB22-43 aa

PF22253DUF694838-70 aa

PF01978TrmB59-69 aa

PF02319WHD_E2F_TDP119-187 aa

PF22253DUF6948145-157 aa

PF01978TrmB167-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G550800	`PF02319`	WHD_E2F_TDP	21	52	6.9e-22	77.7
TkA02G550800	`PF01978`	TrmB	22	43	0.0026	18.3
TkA02G550800	`PF22253`	DUF6948	38	70	0.36	11.7
TkA02G550800	`PF01978`	TrmB	59	69	0.0026	18.3
TkA02G550800	`PF02319`	WHD_E2F_TDP	119	187	6.9e-22	77.7
TkA02G550800	`PF22253`	DUF6948	145	157	0.36	11.7
TkA02G550800	`PF01978`	TrmB	167	186	0.0026	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LSZ4`	Arabidopsis thaliana	sp\|Q8LSZ4\|E2FE_ARATH E2F transcription factor-like E2FE	48.700%	Swiss-Prot	Medium
`Q8RWL0`	Arabidopsis thaliana	sp\|Q8RWL0\|E2FF_ARATH E2F transcription factor-like E2FF	41.600%	Swiss-Prot	Medium
`Q9LFQ9`	Arabidopsis thaliana	sp\|Q9LFQ9\|E2FD_ARATH E2F transcription factor-like E2FD	41.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card