TkA02G448680 | RubberDandelionOmics

Gene overview

TkA02G448680

Reference: TK1151 Chr: Chr02 Coordinates: 114103537-114106489 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1953 bp · TkA02G448680|TK1151|cDNA

TTATGCATAGACAAATACGATTTGTTAGCCCTTTTGTATAAAGATGAAGGTATAGTGGGACACCAGGTCAAAATGGGTGTTGGCTGCTCTTCTTCTTCATTCTCCCTTTCTTTACCCAATCACCACTGCTTTTCATCCACTCTCAATCACCCCAAATCAACGTCTACATTCATTCTCCCCACTAACAATTATTCGCATTTCGACCAACCTTCGCGTAAATTCTTAATGAATTCGCCCCCTAAATGCGGCAGCGGTAGCAT...

CDS

Download CDS FASTA

1653 bp · TkA02G448680|TK1151|CDS

ATGGGTGTTGGCTGCTCTTCTTCTTCATTCTCCCTTTCTTTACCCAATCACCACTGCTTTTCATCCACTCTCAATCACCCCAAATCAACGTCTACATTCATTCTCCCCACTAACAATTATTCGCATTTCGACCAACCTTCGCGTAAATTCTTAATGAATTCGCCCCCTAAATGCGGCAGCGGTAGCATTCCAGAAATCAAAACCACTACACAACAAAGCTTAGTGAAAACCCCGATGTCTGATCCTCACACGATTGACTC...

Protein

Download Protein FASTA

550 aa · TkA02G448680|TK1151|PROTEIN

MGVGCSSSSFSLSLPNHHCFSSTLNHPKSTSTFILPTNNYSHFDQPSRKFLMNSPPKCGSGSIPEIKTTTQQSLVKTPMSDPHTIDSELLRKLVYDALVWSSLHGLVVGDRNVQRSGSTPGVGLVHAPIALLPNSFPESHWNQACELAPIFNELVDRVSLDGKFLQDTLSRTKKVDAFTSRLLDIHSRMLQIGKKEDIRLGLHRSDYMLDENTNLLLQIELNTISCSFSGLSCLVSDLHRSLLSQYNKHLGVDSRRIPIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G448680`
TK1151 ID	TkA02G448680
OH-1004 ID	LXL04_014184
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G448680

Location Chr02:114103537-114106489 (-)

Description Similar to GSH2: Glutathione synthetase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27380`	Glutathione synthetase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014184 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006520 amino acid metabolic process Biological Process

GO:0006750 glutathione biosynthetic process Biological Process

GO:0006950 response to stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004363 glutathione synthase activity Molecular Function

KEGG gene cross-reference

ath:AT5G27380

hsa:2937

sly:543537

xla:394329

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.892

Rank 1 · TkA02G448680 · TK1151

Cytoplasm0.141

Rank 2 · TkA02G448680 · TK1151

Peroxisome0.083

Rank 3 · TkA02G448680 · TK1151

Mitochondrion0.068

Rank 4 · TkA02G448680 · TK1151

Nucleus0.049

Rank 5 · TkA02G448680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03917GSH_synth_ATP89-549 aa

PF03199GSH_synthase157-200 aa

PF03199GSH_synthase282-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G448680	`PF03917`	GSH_synth_ATP	89	549	4.8e-130	434.3
TkA02G448680	`PF03199`	GSH_synthase	157	200	6.5e-36	123.9
TkA02G448680	`PF03199`	GSH_synthase	282	381	6.5e-36	123.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P46416`	Arabidopsis thaliana	sp\|P46416\|GSHB_ARATH Glutathione synthetase, chloroplastic	66.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card