TkA02G446860 | RubberDandelionOmics

Gene overview

TkA02G446860

Reference: TK1151 Chr: Chr02 Coordinates: 113602113-113607792 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3444 bp · TkA02G446860|TK1151|cDNA

TTGTTGACTTCCTGTGAAAGCAGTGGAGGGTGGTCATGGCACTCGGTTGGTCGGCGTCAGACTAGACAAACTGAATATCCAAATCTGAAGTTTTGTCGATCCACTTCACTTTTCAACCTCCATTGTCGAGCTCAGCCCTAAGCTCCGGGTTTGTTCGAGAATATTTGTGTCTTCCAAGATAGATTGGGACACTGGTATATACAAAAACAATGCAAATGCCAAAATCCAGATTGAATTTATCAACACAAGAAGCATTGTCA...

CDS

Download CDS FASTA

1470 bp · TkA02G446860|TK1151|CDS

ATGCAAATGCCAAAATCCAGATTGAATTTATCAACACAAGAAGCATTGTCAACATCCCCAAGAGCAAGGGAGGTTGAAGGTCCTTCAAGATGGAGTGAATACTTGAATCAGGAAACGGGCACTCCAATGCCTTCTAGAACCTCCCGGAACAATGGATCAGAAGTATCATTCCAGCTTCCTGGAGTATCTCATAAGGGATTAAACGTGCAGTGGGTATATCAACTTACCCAAGTTGCACAAGGACTAATGGCCAAAATCTA...

Protein

Download Protein FASTA

489 aa · TkA02G446860|TK1151|PROTEIN

MQMPKSRLNLSTQEALSTSPRAREVEGPSRWSEYLNQETGTPMPSRTSRNNGSEVSFQLPGVSHKGLNVQWVYQLTQVAQGLMAKIYRLNQILDYPDSVNHVFTEAFWKAGVFPNCPKICTLLSKKFPEHHGKLQLERVDKVALDALNDQAEAHLQSLEPWIQLLLDIVAFREQALRLILDLSSTVITLLPHQNSLILHAFMDLFCSFVRVNLFAEKLPRKMMVQVYNLLHAILRNDRDCDFYYRLVQFIDAYDPPLKGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G446860`
TK1151 ID	TkA02G446860
OH-1004 ID	LXL04_014221
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 91.002 / OH-1004 32.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G446860

Location Chr02:113602113-113607792 (+)

Description Similar to NAP1: Protein NAP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35110`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0544500`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000902 cell morphogenesis Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007155 cell adhesion Biological Process

GO:0007354 zygotic determination of anterior/posterior axis, embryo Biological Process

GO:0008064 regulation of actin polymerization or depolymerization Biological Process

GO:0008078 mesodermal cell migration Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010172 embryonic body morphogenesis Biological Process

GO:0010592 positive regulation of lamellipodium assembly Biological Process

KEGG gene cross-reference

ath:AT2G35110

ddi:DDB_G0274519

nve:5517043

rno:58823

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.475

Rank 1 · TkA02G446860 · TK1151

Cytoplasm0.436

Rank 2 · TkA02G446860 · TK1151

Mitochondrion0.087

Rank 3 · TkA02G446860 · TK1151

Cell membrane0.063

Rank 4 · TkA02G446860 · TK1151

Golgi apparatus0.058

Rank 5 · TkA02G446860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09735Nckap175-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G446860	`PF09735`	Nckap1	75	446	4.6e-84	284.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5S2C4`	Arabidopsis thaliana	sp\|Q5S2C4\|NCKP1_ARATH Protein NAP1	76.600%	Swiss-Prot	High
`Q6ZBH9`	Oryza sativa subsp. japonica	sp\|Q6ZBH9\|NCKP1_ORYSJ Probable protein NAP1	76.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card