TkA02G412780 | RubberDandelionOmics

Gene overview

TkA02G412780

Reference: TK1151 Chr: Chr02 Coordinates: 104983588-104984121 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA02G412780|TK1151|cDNA

ATGAAGTACACAGGGAGGCGAATTCCCGATACTACCCTCACAAGGACCTCGTTGTTGACATCGGTTTGTTCACCGGGGAAGCTATTTAGAGGGGTACGGCAGCGTCACTGGGGAAAATGGGTGGCGGAAATCCGATTGCCGAGAAATCGGACTAGGGTTTGGCTTGGGACATTTGATACAGCTGAAGAAGCCGCTATTGCGTATGATACAGCTGCGTATTTGTTAAGGGGTGATTACGCGAACTTAAATTTCCCGAATTT...

CDS

Download CDS FASTA

504 bp · TkA02G412780|TK1151|CDS

ATGAAGTACACAGGGAGGCGAATTCCCGATACTACCCTCACAAGGACCTCGTTGTTGACATCGGTTTGTTCACCGGGGAAGCTATTTAGAGGGGTACGGCAGCGTCACTGGGGAAAATGGGTGGCGGAAATCCGATTGCCGAGAAATCGGACTAGGGTTTGGCTTGGGACATTTGATACAGCTGAAGAAGCCGCTATTGCGTATGATACAGCTGCGTATTTGTTAAGGGGTGATTACGCGAACTTAAATTTCCCGAATTT...

Protein

Download Protein FASTA

167 aa · TkA02G412780|TK1151|PROTEIN

MKYTGRRIPDTTLTRTSLLTSVCSPGKLFRGVRQRHWGKWVAEIRLPRNRTRVWLGTFDTAEEAAIAYDTAAYLLRGDYANLNFPNLKNQLKANSINGNTAALLEAKLQALSHKPESEASRNSEVNNEKIKKQIEERASDVVEGVQLSRMPSLDMDMIWDAIFVSDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G412780`
TK1151 ID	TkA02G412780
OH-1004 ID	LXL04_014563
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 66.541 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G412780

Location Chr02:104983588-104984121 (+)

Description Similar to ERF062: Ethylene-responsive transcription factor ERF062

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13620`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g22190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g36060`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g78080`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g39780`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009415 response to water Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G22190

ath:AT1G36060

ath:AT1G78080

ath:AT4G13620

ath:AT4G39780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.877

Rank 1 · TkA02G412780 · TK1151

Cytoplasm0.148

Rank 2 · TkA02G412780 · TK1151

Plastid0.033

Rank 3 · TkA02G412780 · TK1151

Cell membrane0.031

Rank 4 · TkA02G412780 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA02G412780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP229-77 aa

PF14112DUF428453-135 aa

PF14566PTPlike_phytase59-144 aa

PF06097DUF94560-140 aa

PF02006PPS_PS95-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G412780	`PF00847`	AP2	29	77	4.9e-14	53.1
TkA02G412780	`PF14112`	DUF4284	53	135	0.21	13.0
TkA02G412780	`PF14566`	PTPlike_phytase	59	144	0.15	12.9
TkA02G412780	`PF06097`	DUF945	60	140	0.043	13.6
TkA02G412780	`PF02006`	PPS_PS	95	150	0.038	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVQ0`	Arabidopsis thaliana	sp\|Q9SVQ0\|ERF62_ARATH Ethylene-responsive transcription factor ERF062	53.300%	Swiss-Prot	High
`Q9LM15`	Arabidopsis thaliana	sp\|Q9LM15\|RA213_ARATH Ethylene-responsive transcription factor RAP2-13	67.400%	Swiss-Prot	Medium
`Q9SKW5`	Arabidopsis thaliana	sp\|Q9SKW5\|ERF55_ARATH Ethylene-responsive transcription factor ERF055	55.700%	Swiss-Prot	Medium
`Q8H1E4`	Arabidopsis thaliana	sp\|Q8H1E4\|RAP24_ARATH Ethylene-responsive transcription factor RAP2-4	85.900%	Swiss-Prot	Low
`O65665`	Arabidopsis thaliana	sp\|O65665\|ERF60_ARATH Ethylene-responsive transcription factor ERF060	78.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card