TkA02G270790 | RubberDandelionOmics

Gene overview

TkA02G270790

Reference: TK1151 Chr: Chr02 Coordinates: 69146712-69163982 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1787 bp · TkA02G270790|TK1151|cDNA

AAGAAAGTTCAGGGAATGTAGGTATAGATAGTGAGTTAGTTTCAACTTTGCGCTTTTGGTGGAGAAGGACCGACTCCTTCTCCTTCTCTCGTCGGCTCAATCCCACTTTGAAAAACAACCCTAACTACCTCCTCTCGCCATTTTTTCTCGAAGCCTCTACCTTCTGTCTGTTCTTTTGCGTCGCCGGCAAGCAAAGAGTGTGAGAGACTCGGAGGGTGCCGCTGTGAAAGAGCCGCCGCCGGAAGAGTTCGTCGCCGAAG...

CDS

Download CDS FASTA

1110 bp · TkA02G270790|TK1151|CDS

ATGCCTGACCCGCTTGTTTTTGACAATGGAACTGGAATGACGAAGGCAGGGTTTGCCGGTGATGATGCTCCTAAAGTCGTGTTCCCCAGTATTGTTGGTAGGCCACGAGACACTGGTTCAATGGTCGATGAAAAAGATGCTCATGTAGGACGAGATGCCCTGTCCAAAAGTGGTATATTGAATTTGAAATATCCTATTGACCATGGTATTATCTGCAACTCGGACGATATGGAAAGGATTTGGCATCACACTTTCTATAA...

Protein

Download Protein FASTA

369 aa · TkA02G270790|TK1151|PROTEIN

MPDPLVFDNGTGMTKAGFAGDDAPKVVFPSIVGRPRDTGSMVDEKDAHVGRDALSKSGILNLKYPIDHGIICNSDDMERIWHHTFYNELRVAPEEQPVVLTEELLNPKANREKMAQIMFETFNVPAVYFGIQPVLSMFASGRTTGMVLHSGDGVSDAVPVYEGYAIPQAALRINLGGRELTDFLMKILTGGSMFTTAVERENIRDMKEKCAYVALDYDQELYTAKSSSSVEKKYQLPDHQVITIGVERFRCPEVLFQPSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G270790`
TK1151 ID	TkA02G270790
OH-1004 ID	LXL04_015957
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.374 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G270790

Location Chr02:69146712-69163982 (+)

Description Similar to ACT7: Actin-7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09810`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	One plant actin isovariant, ACT7, is induced by auxin and required for normal callus formation.2001 · DOI: 10.1105/tpc.010026 A Framework for Lateral Membrane Trafficking and Polar Tethering of the PEN3 ATP-Binding Cassette Transporter.2016 · DOI: 10.1104/pp.16.01252

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XLF2`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release
`Os03g0718100`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release
`UniProt: A2XNS1`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release
`UniProt: P0C539`	Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015957 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009733 response to auxin Biological Process

GO:0009845 seed germination Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0015031 protein transport Biological Process

GO:0048364 root development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051301 cell division Biological Process

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT5G09810

dosa:Os03g0718100

dosa:Os03g0836000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.730

Rank 1 · TkA02G270790 · TK1151

Nucleus0.271

Rank 2 · TkA02G270790 · TK1151

Cell membrane0.103

Rank 3 · TkA02G270790 · TK1151

Mitochondrion0.061

Rank 4 · TkA02G270790 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA02G270790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022Actin4-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G270790	`PF00022`	Actin	4	368	6.3e-122	407.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P53492`	Arabidopsis thaliana	sp\|P53492\|ACT7_ARATH Actin-7	74.500%	Swiss-Prot	High
`A2XLF2`	Oryza sativa subsp. indica	sp\|A2XLF2\|ACT1_ORYSI Actin-1	72.600%	Swiss-Prot	High
`Q10DV7`	Oryza sativa subsp. japonica	sp\|Q10DV7\|ACT1_ORYSJ Actin-1	72.600%	Swiss-Prot	High
`A2XNS1`	Oryza sativa subsp. indica	sp\|A2XNS1\|ACT3_ORYSI Actin-3	73.200%	Swiss-Prot	High
`P0C539`	Oryza sativa subsp. indica	sp\|P0C539\|ACT2_ORYSI Actin-2	73.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card