TkA02G261600 | RubberDandelionOmics

Gene overview

TkA02G261600

Reference: TK1151 Chr: Chr02 Coordinates: 66800247-66801769 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · TkA02G261600|TK1151|cDNA

ATTTCCCTTTTGAAAATGGCTCCGAAACGCCGGCGAACGACGGAGAGTGAAAGCAAACAAGTAACGCAAAACTGTTCGTCAAGGATCACCAGAGCTCGGATTTCATCGAAGAAGATAAATAATAACTCTTCGCCAGTGGTCGTCTTCGCTCACGGCGCTGGCGCTCCTTCATCTTCCGAGTGGATGATTAGATGGAGAAACTTATTGGCTGACGCACTAAAGGCGATCGAAGTTGTAACGTTCGACTATCCATACATTTC...

CDS

Download CDS FASTA

717 bp · TkA02G261600|TK1151|CDS

ATGGCTCCGAAACGCCGGCGAACGACGGAGAGTGAAAGCAAACAAGTAACGCAAAACTGTTCGTCAAGGATCACCAGAGCTCGGATTTCATCGAAGAAGATAAATAATAACTCTTCGCCAGTGGTCGTCTTCGCTCACGGCGCTGGCGCTCCTTCATCTTCCGAGTGGATGATTAGATGGAGAAACTTATTGGCTGACGCACTAAAGGCGATCGAAGTTGTAACGTTCGACTATCCATACATTTCCAAAAGAAAGCCTCC...

Protein

Download Protein FASTA

238 aa · TkA02G261600|TK1151|PROTEIN

MAPKRRRTTESESKQVTQNCSSRITRARISSKKINNNSSPVVVFAHGAGAPSSSEWMIRWRNLLADALKAIEVVTFDYPYISKRKPPPKAEKLVEFHSDFVKKIASKYPKHPLILVGKSMGSRVSCMVAVENDIKASAVICLGYPLKGTKGAIRDEPLLQLSVPTMFVQGNKDGLCPLGSLEGVRKKMKALNTVYVVENGDHSFKIGKKNLEMAGITQEEAERLAVQAIATFVSQISK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G261600`
TK1151 ID	TkA02G261600
OH-1004 ID	LXL04_029537
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G261600`
Location	Chr02:66800247-66801769 (-)
Description	Similar to Kansl3: KAT8 regulatory NSL complex subunit 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_029537` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:1903108 regulation of mitochondrial transcription Biological Process GO:0000123 histone acetyltransferase complex Cellular Component GO:0000922 spindle pole Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005874 microtubule Cellular Component GO:0044545 NSL complex Cellular Component
KEGG gene cross-reference	dre:555951 hsa:55683 hsa:93081 mmu:226976 rno:316328 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · TkA02G261600 · TK1151

Nucleus0.493

Rank 2 · TkA02G261600 · TK1151

Cell membrane0.071

Rank 3 · TkA02G261600 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA02G261600 · TK1151

Mitochondrion0.049

Rank 5 · TkA02G261600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05563SpvD16-71 aa

PF08386Abhydrolase_419-46 aa

PF09752ABHD1821-99 aa

PF20434BD-FAE32-134 aa

PF12146Hydrolase_435-62 aa

PF20408Abhydrolase_1140-233 aa

PF00561Abhydrolase_140-143 aa

PF12697Abhydrolase_642-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G261600	`PF05563`	SpvD	16	71	0.072	13.6
TkA02G261600	`PF08386`	Abhydrolase_4	19	46	0.0094	16.8
TkA02G261600	`PF09752`	ABHD18	21	99	0.086	12.7
TkA02G261600	`PF20434`	BD-FAE	32	134	0.0025	18.1
TkA02G261600	`PF12146`	Hydrolase_4	35	62	7.9e-08	32.6
TkA02G261600	`PF20408`	Abhydrolase_11	40	233	2.1e-41	142.5
TkA02G261600	`PF00561`	Abhydrolase_1	40	143	4.6e-14	53.4
TkA02G261600	`PF12697`	Abhydrolase_6	42	145	2.6e-07	32.2
TkA02G261600	`PF07859`	Abhydrolase_3	42	148	0.036	14.5
TkA02G261600	`PF01083`	Cutinase	42	147	0.22	12.1
TkA02G261600	`PF12146`	Hydrolase_4	91	143	7.9e-08	32.6
TkA02G261600	`PF07819`	PGAP1	95	148	0.03	14.8
TkA02G261600	`PF12695`	Abhydrolase_5	96	203	2.2e-06	28.3
TkA02G261600	`PF01738`	DLH	103	235	0.00032	21.1
TkA02G261600	`PF08386`	Abhydrolase_4	132	204	0.0094	16.8
TkA02G261600	`PF00561`	Abhydrolase_1	156	205	4.6e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card