TkA02G193570 | RubberDandelionOmics

Gene overview

TkA02G193570

Reference: TK1151 Chr: Chr02 Coordinates: 49617561-49619178 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1031 bp · TkA02G193570|TK1151|cDNA

TTTCACCATGACACATGATGATGGTCATTTTGGGGTGTAGCTTAAAAGGGTCATCTATTTTTAGTTTTACGGTCATATACTCTCTGCCGGATTTTCTTACCATTCGATCAAGGTAACACCATGGGAAAGAACAAGCAACGGAAGAACGACGATGAACAGAATCATGTGGAAACTAATAATGATGGCGCAGATGAAAACTCTAACGAATCAAAAACCAAAAATAACAAGCAAGGTCAAGGAGCGATAGTGTTGGGAGTTTA...

CDS

Download CDS FASTA

777 bp · TkA02G193570|TK1151|CDS

ATGGGAAAGAACAAGCAACGGAAGAACGACGATGAACAGAATCATGTGGAAACTAATAATGATGGCGCAGATGAAAACTCTAACGAATCAAAAACCAAAAATAACAAGCAAGGTCAAGGAGCGATAGTGTTGGGAGTTTATCTTCATTGTCAGGGTTGCGTTGAAACGGTCGTGAATTCGCTAAGAGGATTCGACGGCGTTGAAGAAATAGAACCGAATACGAAGGATCATCGTGTGGTCGTGAAAGGCAAAACTGCCGA...

Protein

Download Protein FASTA

258 aa · TkA02G193570|TK1151|PROTEIN

MGKNKQRKNDDEQNHVETNNDGADENSNESKTKNNKQGQGAIVLGVYLHCQGCVETVVNSLRGFDGVEEIEPNTKDHRVVVKGKTADPIRVAERVRQKSGKHVELISPIPKKQQEKKPDPEKKPEVVETVLKMHLHCEGCAKDVKHCLHKMQGVQSVNVDMKTSHVTVKGIFDPKDLVTYISKRAGRHAEMVNMKNQKKNKNGGHEQKEDNNDQNSKKENQKEKDKNTGGLAYPQVPPGLVYAPQLFSDENANACSIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G193570`
TK1151 ID	TkA02G193570
OH-1004 ID	LXL04_016091
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G193570

Location Chr02:49617561-49619178 (+)

Description Similar to HIPP08: Heavy metal-associated isoprenylated plant protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63530`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g60800`	Heavy-metal-binding protein.	The zinc-binding nuclear protein HIPP3 acts as an upstream regulator of the salicylate-dependent plant immunity pathway and of flowering time in Arabidopsis thaliana.2015 · DOI: 10.1111/nph.13419
`At1g29000`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g02960`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g02600`	Required for root meristem maintenance after germination.	Arabidopsis NPCC6/NaKR1 is a phloem mobile metal binding protein necessary for phloem function and root meristem maintenance.2010 · DOI: 10.1105/tpc.110.080010 NaKR1 regulates long-distance movement of FLOWERING LOCUS T in Arabidopsis.2016 · DOI: 10.1038/nplants.2016.75

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016091 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0046872 metal ion binding Molecular Function

GO:0046914 transition metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G29000

ath:AT3G02960

ath:AT5G03380

ath:AT5G63530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.481

Rank 1 · TkA02G193570 · TK1151

Cytoplasm0.423

Rank 2 · TkA02G193570 · TK1151

Nucleus0.277

Rank 3 · TkA02G193570 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA02G193570 · TK1151

Mitochondrion0.033

Rank 5 · TkA02G193570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14851FAM1766-37 aa

PF07792Afi16-43 aa

PF01496V_ATPase_I12-32 aa

PF08577PI31_Prot_C14-26 aa

PF00403HMA48-100 aa

PF18892DUF565149-53 aa

PF19803DUF628650-110 aa

PF10656DUF248360-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G193570	`PF14851`	FAM176	6	37	0.012	16.1
TkA02G193570	`PF07792`	Afi1	6	43	6.7	7.9
TkA02G193570	`PF01496`	V_ATPase_I	12	32	1.3	7.5
TkA02G193570	`PF08577`	PI31_Prot_C	14	26	0.91	11.5
TkA02G193570	`PF00403`	HMA	48	100	1.9e-22	80.1
TkA02G193570	`PF18892`	DUF5651	49	53	0.35	11.5
TkA02G193570	`PF19803`	DUF6286	50	110	4.5e-05	24.6
TkA02G193570	`PF10656`	DUF2483	60	86	0.014	16.5
TkA02G193570	`PF08577`	PI31_Prot_C	86	119	0.91	11.5
TkA02G193570	`PF07792`	Afi1	111	111	6.7	7.9
TkA02G193570	`PF01496`	V_ATPase_I	118	225	1.3	7.5
TkA02G193570	`PF19803`	DUF6286	131	169	4.5e-05	24.6
TkA02G193570	`PF18892`	DUF5651	133	148	0.35	11.5
TkA02G193570	`PF00403`	HMA	134	187	1.9e-22	80.1
TkA02G193570	`PF10656`	DUF2483	150	169	0.014	16.5
TkA02G193570	`PF10656`	DUF2483	175	186	0.014	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5D3`	Arabidopsis thaliana	sp\|Q9C5D3\|HIP7_ARATH Heavy metal-associated isoprenylated plant protein 7	40.700%	Swiss-Prot	Medium
`Q9FJH5`	Arabidopsis thaliana	sp\|Q9FJH5\|HIP3_ARATH Heavy metal-associated isoprenylated plant protein 3	31.500%	Swiss-Prot	Medium
`Q9SHQ8`	Arabidopsis thaliana	sp\|Q9SHQ8\|HIP4_ARATH Heavy metal-associated isoprenylated plant protein 4	30.300%	Swiss-Prot	Medium
`Q9M8T7`	Arabidopsis thaliana	sp\|Q9M8T7\|HIP8_ARATH Heavy metal-associated isoprenylated plant protein 8	38.800%	Swiss-Prot	Low
`Q8LDS4`	Arabidopsis thaliana	sp\|Q8LDS4\|NAKR1_ARATH Protein SODIUM POTASSIUM ROOT DEFECTIVE 1	46.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card