TkA02G167280 | RubberDandelionOmics

Gene overview

TkA02G167280

Reference: TK1151 Chr: Chr02 Coordinates: 42859528-42860961 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

641 bp · TkA02G167280|TK1151|cDNA

ACTTTTTTAAACATTTTATATCACGAAGGAAGAAAAATCAGCGTACGAGTGCCGCAGAACAACGTCTGAAGCAGAATTTGCGAGTGGGAACTTTCGTCGATCGGAGGAAAAGATGTCAGGAGTTACGAACGAGGAAGACAAGAAGCCGGCCGGAGATCAAGGCGCTCATATCAATTTGAAAGTCAAAGGACAGGATGGGAATGAGGTGTTTTTCAGGATCAAAAGGAGCACACAACTTAAGAAGCTGATGAATGCATACT...

CDS

Download CDS FASTA

306 bp · TkA02G167280|TK1151|CDS

ATGTCAGGAGTTACGAACGAGGAAGACAAGAAGCCGGCCGGAGATCAAGGCGCTCATATCAATTTGAAAGTCAAAGGACAGGATGGGAATGAGGTGTTTTTCAGGATCAAAAGGAGCACACAACTTAAGAAGCTGATGAATGCATACTGTGAGCGGCAATCTGTTGAGCTCAGCTCTATTGCTTTCTTGTTTGATGGTCGCCGCCTTCGAGCAGAGCAGACTCCAGATGAGTTGGAAATGGAGGATGGTGATGAGATTGA...

Protein

Download Protein FASTA

101 aa · TkA02G167280|TK1151|PROTEIN

MSGVTNEEDKKPAGDQGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCERQSVELSSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGGLLWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G167280`
TK1151 ID	TkA02G167280
OH-1004 ID	LXL04_016232
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G167280

Location Chr02:42859528-42860961 (-)

Description Similar to SUMO2: Small ubiquitin-related modifier 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55160`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285
`At4g26840`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	SIZ1 small ubiquitin-like modifier E3 ligase facilitates basal thermotolerance in Arabidopsis independent of salicylic acid.2006 · DOI: 10.1104/pp.106.088831 Genetic analysis of SUMOylation in Arabidopsis: conjugation of SUMO1 and SUMO2 to nuclear proteins is essential.2007 · DOI: 10.1104/pp.107.102285 Sumoylation of Arabidopsis heat shock factor A2 (HsfA2) modifies its activity during acquired thermotholerance.2010 · DOI: 10.1007/s11103-010-9652-1
`At5g55170`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0918300`	Ubiquitin-like protein which can be covalently attached to target lysines as a monomer.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016232 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0009408 response to heat Biological Process

GO:0010286 heat acclimation Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0120290 stalled replication fork localization to nuclear periphery Biological Process

GO:1990426 mitotic recombination-dependent replication fork processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005940 septin ring Cellular Component

GO:0009536 plastid Cellular Component

GO:0030998 linear element Cellular Component

KEGG gene cross-reference

ath:AT4G26840

ath:AT5G55160

ath:AT5G55170

dosa:Os01g0918300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.736

Rank 1 · TkA02G167280 · TK1151

Cytoplasm0.431

Rank 2 · TkA02G167280 · TK1151

Cell membrane0.049

Rank 3 · TkA02G167280 · TK1151

Endoplasmic reticulum0.038

Rank 4 · TkA02G167280 · TK1151

Mitochondrion0.037

Rank 5 · TkA02G167280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11976Rad60-SLD20-90 aa

PF00240ubiquitin22-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G167280	`PF11976`	Rad60-SLD	20	90	1.7e-25	89.3
TkA02G167280	`PF00240`	ubiquitin	22	92	2.4e-16	60.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLP6`	Arabidopsis thaliana	sp\|Q9FLP6\|SUMO2_ARATH Small ubiquitin-related modifier 2	91.400%	Swiss-Prot	High
`P55852`	Arabidopsis thaliana	sp\|P55852\|SUMO1_ARATH Small ubiquitin-related modifier 1	91.200%	Swiss-Prot	High
`Q9FLP5`	Arabidopsis thaliana	sp\|Q9FLP5\|SUMO3_ARATH Small ubiquitin-related modifier 3	51.600%	Swiss-Prot	High
`P55857`	Oryza sativa subsp. japonica	sp\|P55857\|SUMO1_ORYSJ Small ubiquitin-related modifier 1	89.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card