RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G047050
Reference: TK1151 Chr: Chr02 Coordinates: 12135616-12143115 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

963 bp · TkA02G047050|TK1151|cDNA

ATGACCCATGTTTTTCAATGGAATGGCGAGGGGAAAGCTCTTGTAGGATTAGTAGAAGGAATCGCGGATTATTCGATTTTGAAAGCCAATTATTTTCCACCGGGTTTTGCTAAACCGGGAAGTGGTGAGAAATGGGATCAGGGGTATGATTTCACGTCCCGGTTTCTTGAGTATTGTGATGGGCTTGTTCCAGGGTTCGTGGCAAAGCTTAACAAAAAGATAAGGTTTACTTTCCATGTTAAGAAATTGCCGGAAAAAGG...

CDS

Download CDS FASTA

963 bp · TkA02G047050|TK1151|CDS

ATGACCCATGTTTTTCAATGGAATGGCGAGGGGAAAGCTCTTGTAGGATTAGTAGAAGGAATCGCGGATTATTCGATTTTGAAAGCCAATTATTTTCCACCGGGTTTTGCTAAACCGGGAAGTGGTGAGAAATGGGATCAGGGGTATGATTTCACGTCCCGGTTTCTTGAGTATTGTGATGGGCTTGTTCCAGGGTTCGTGGCAAAGCTTAACAAAAAGATAAGGTTTACTTTCCATGTTAAGAAATTGCCGGAAAAAGG...

Protein

Download Protein FASTA

320 aa · TkA02G047050|TK1151|PROTEIN

MTHVFQWNGEGKALVGLVEGIADYSILKANYFPPGFAKPGSGEKWDQGYDFTSRFLEYCDGLVPGFVAKLNKKIRFTFHVKKLPEKGREFFPDAANKVTLGAFVSTDQNNGLKINIRKCKIFGVGVNHRPIREMAERLGKKLSSWKSSVMSLGGRAVICKSVLGSLGSYLFSIYKAPAAVTNKLESLRRSFFWGEKDNCKKISWVAWKNVLNSHDKGGLNIGSLKAANMALFANGLGEVIPSNRRMANWGIICNLDHDLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G047050
TK1151 IDTkA02G047050
OH-1004 IDLXL04_000694
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)44.100
Protein coverage (%)TK1151 83.125 / OH-1004 16.204
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G047050
LocationChr02:12135616-12143115 (+)
DescriptionSimilar to LBD13: LOB domain-containing protein 13
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010016 shoot system morphogenesis Biological Process
GO:0010311 lateral root formation Biological Process
GO:0010628 positive regulation of gene expression Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:1905177 tracheary element differentiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0001216 DNA-binding transcription activator activity Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003824 catalytic activity Molecular Function
KEGG gene cross-reference
ath:AT2G30130
ath:AT2G30340
ath:AT2G40470
ath:AT3G27650
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579
Rank 1 · TkA02G047050 · TK1151
Nucleus0.240
Rank 2 · TkA02G047050 · TK1151
Plastid0.085
Rank 3 · TkA02G047050 · TK1151
Endoplasmic reticulum0.085
Rank 4 · TkA02G047050 · TK1151
Cell membrane0.074
Rank 5 · TkA02G047050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04450BSP1-79 aa
PF18005eIF3m_C_helix138-149 aa
PF18005eIF3m_C_helix206-212 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G047050PF04450BSP1791e-2591.5
TkA02G047050PF18005eIF3m_C_helix1381492.48.7
TkA02G047050PF18005eIF3m_C_helix2062122.48.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser