RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G623230
Reference: TK1151 Chr: Chr01 Coordinates: 157314229-157316736 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2409 bp · TkA01G623230|TK1151|cDNA

GATAATAGTACTATTCATATTTAATAGACCTCTTTGTTTTAGTGCGTGGAACGCTCTTTGTTAAGGCGCAAGTAAAACCGAGTAACGTAATTCAAACGGAAACTTTCAATGCCTAACAAATCTCTCTAGAGTCTTCGTCTCCGACGAAAAACCCTAACAATGGCCGAAGAGCAGGCCTTGGCCGATCCGTTAGCCTCCCTCTCCATTCCACCTCTCAGCTCCTCCATCTTCTCCGACGACCTCACATTACCCGACGATTT...

CDS

Download CDS FASTA

2109 bp · TkA01G623230|TK1151|CDS

ATGGCCGAAGAGCAGGCCTTGGCCGATCCGTTAGCCTCCCTCTCCATTCCACCTCTCAGCTCCTCCATCTTCTCCGACGACCTCACATTACCCGACGATTTCCTCTCCTTCGACGAAGACTTCGACATCACCTTTGACAACGACCACCTCCCTTCAGATACCGAAGACTTTTTCAACTCCACCTTCAATCCTTCCAATCCGATTGATCTGTCATCCTCTGATCCTGAATTCAATGAATTTGTGTCTGACCCCGAAACCTT...

Protein

Download Protein FASTA

702 aa · TkA01G623230|TK1151|PROTEIN

MAEEQALADPLASLSIPPLSSSIFSDDLTLPDDFLSFDEDFDITFDNDHLPSDTEDFFNSTFNPSNPIDLSSSDPEFNEFVSDPETFVAESGNLSEHQGDVSGFLNIPSPDDSSKGFLEETLMVLDSQSPESRTENPVSSQGSGNCGSAGSDAAMNCPSPDSGNSVVDHKVKRELGSNFMLKRKKETSDGNSESRTVKYQRSNETSTTTENSNEIDGKDDKKKARLIRNRESAQLSRQRKKHYVEELEDKVRAMHSTIQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G623230
TK1151 IDTkA01G623230
OH-1004 IDLXL04_000276
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G623230
LocationChr01:157314229-157316736 (-)
DescriptionSimilar to BZIP17: bZIP transcription factor 17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g40950 Transcriptional activator involved in salt and osmotic stress responses.
Salt stress responses in Arabidopsis utilize a signal transduction pathway related to endoplasmic reticulum stress signaling.2007 · DOI: 10.1111/j.1365-313x.2007.03195.x
Signaling from the endoplasmic reticulum activates brassinosteroid signaling and promotes acclimation to stress in Arabidopsis.2010 · DOI: 10.1126/scisignal.2001140
At3g10800 Transcriptional activator involved in ER stress responses.
An endoplasmic reticulum stress response in Arabidopsis is mediated by proteolytic processing and nuclear relocation of a membrane-associated transcription factor, bZIP28.2007 · DOI: 10.1105/tpc.106.050021
Identification of an Arabidopsis transmembrane bZIP transcription factor involved in the endoplasmic reticulum stress response.2008 · DOI: 10.1016/j.bbrc.2008.07.021
A membrane-tethered transcription factor defines a branch of the heat stress response in Arabidopsis thaliana.2008 · DOI: 10.1073/pnas.0808463105
Signaling from the endoplasmic reticulum activates brassinosteroid signaling and promotes acclimation to stress in Arabidopsis.2010 · DOI: 10.1126/scisignal.2001140
At3g56660 Transcriptional activator involved in stress responses. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0411300 Transcription factor involved in endoplasmic reticulum (ER) stress response.
Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice.2012 · DOI: 10.1111/j.1365-313x.2011.04844.x
A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.2012 · DOI: 10.1093/pcp/pcr157
Os07g0644100 Transcription factor involved in endoplasmic reticulum (ER) stress response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000276 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006950 response to stress Biological Process
GO:0006986 response to unfolded protein Biological Process
GO:0009408 response to heat Biological Process
GO:0030968 endoplasmic reticulum unfolded protein response Biological Process
GO:0034976 response to endoplasmic reticulum stress Biological Process
GO:0042538 hyperosmotic salinity response Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005635 nuclear envelope Cellular Component
KEGG gene cross-reference
ath:AT2G40950
ath:AT3G10800
ath:AT3G56660
dosa:Os05g0411300
dosa:Os07g0644100
osa:4338781
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.825
Rank 1 · TkA01G623230 · TK1151
Endoplasmic reticulum0.399
Rank 2 · TkA01G623230 · TK1151
Cell membrane0.121
Rank 3 · TkA01G623230 · TK1151
Cytoplasm0.076
Rank 4 · TkA01G623230 · TK1151
Golgi apparatus0.045
Rank 5 · TkA01G623230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12496BNIP26-58 aa
PF09716ETRAMP200-226 aa
PF12496BNIP2203-238 aa
PF00170bZIP_1218-278 aa
PF07716bZIP_2218-265 aa
PF09716ETRAMP337-379 aa
PF06624RAMP4341-381 aa
PF07716bZIP_2349-360 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G623230PF12496BNIP26583.58.7
TkA01G623230PF09716ETRAMP2002260.06713.9
TkA01G623230PF12496BNIP22032383.58.7
TkA01G623230PF00170bZIP_12182781.4e-1248.3
TkA01G623230PF07716bZIP_22182654.2e-0524.2
TkA01G623230PF09716ETRAMP3373790.06713.9
TkA01G623230PF06624RAMP43413810.06314.0
TkA01G623230PF07716bZIP_23493604.2e-0524.2
TkA01G623230PF06624RAMP46226440.06314.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22208Arabidopsis thalianasp|O22208|BZP17_ARATH bZIP transcription factor 1744.400%Swiss-ProtMedium
Q9SG86Arabidopsis thalianasp|Q9SG86|BZP28_ARATH bZIP transcription factor 2842.300%Swiss-ProtMedium
Q9LXX4Arabidopsis thalianasp|Q9LXX4|BZP49_ARATH bZIP transcription factor 4942.600%Swiss-ProtMedium
Q6AU90Oryza sativa subsp. japonicasp|Q6AU90|BZP39_ORYSJ bZIP transcription factor 3942.000%Swiss-ProtMedium
Q8LIB3Oryza sativa subsp. japonicasp|Q8LIB3|BZP60_ORYSJ bZIP transcription factor 6040.000%Swiss-ProtMedium

JBrowse

View in Genome Browser