Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1729 bp · TkA01G614480|TK1151|cDNA
TTAAAATACTACGACGGTGATTGGATGAGATCATGAGAGTATACCATTCACTTATCCCATCCGCCGGTCATCGCCGGAATGCGAAACAGAAAAATGACTTTCTCTATTCAATCAGCTATTGTAACCTTGATTCTATATAGTGCAATCATCCAATCGGAATCATACACTTCCTCATCAATCCGTCTTCCTCACTCTCAATCTAGATCTCCGCCTGTTACTGTTTCCGTCACCGAATATGGGGCCACCGGCGATGGGGTCCA...
1431 bp · TkA01G614480|TK1151|CDS
ATGCGAAACAGAAAAATGACTTTCTCTATTCAATCAGCTATTGTAACCTTGATTCTATATAGTGCAATCATCCAATCGGAATCATACACTTCCTCATCAATCCGTCTTCCTCACTCTCAATCTAGATCTCCGCCTGTTACTGTTTCCGTCACCGAATATGGGGCCACCGGCGATGGGGTCCACTACGACACCGAACCTATTCAGTCCGCAATCGACGCTTGCTCGTCCGCGGGAGGTGGTCGAGTCGTCTTCCCGCCGGG...
Protein
Download Protein FASTA476 aa · TkA01G614480|TK1151|PROTEIN
MRNRKMTFSIQSAIVTLILYSAIIQSESYTSSSIRLPHSQSRSPPVTVSVTEYGATGDGVHYDTEPIQSAIDACSSAGGGRVVFPPGNYLTATVFLKSRVVLEVQKNATVLGGTRLEDYPVEQSRWYVVLAEDAEDVGITGGGEINGQGLEFVVRFDERKNVMVSWNQTGACSGDECRPRLVGFIRSKNVRVWDVHLTEPAYWCLHLVQCDNTYIHDISIYGDFNTPNNDGIDIDDSNNTLITRCNINTGDDAICPKTYD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G614480 |
|---|---|
| TK1151 ID | TkA01G614480 |
| OH-1004 ID | LXL04_000397 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.300 |
| Protein coverage (%) | TK1151 99.580 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G614480 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:154958644-154960715 (+) | |||||||||
| Description | Similar to GSVIVT00026920001: Probable polygalacturonase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0045490 pectin catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0016020 membrane Cellular Component GO:0004650 polygalacturonase activity Molecular Function GO:0033917 exo-poly-alpha-galacturonosidase activity Molecular Function GO:0047911 galacturan 1,4-alpha-galacturonidase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G02790 ath:AT1G80170 ath:AT3G15720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12708Pect-lyase_RHGA_epim48-99 aaPF00295Glyco_hydro_2874-398 aaPF12708Pect-lyase_RHGA_epim188-296 aaPF13229Beta_helix208-324 aaPF12708Pect-lyase_RHGA_epim278-328 aaPF13229Beta_helix295-393 aaPF12708Pect-lyase_RHGA_epim350-392 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G614480 | PF12708 | Pect-lyase_RHGA_epim | 48 | 99 | 7.6e-14 | 52.7 |
| TkA01G614480 | PF00295 | Glyco_hydro_28 | 74 | 398 | 3.2e-22 | 79.8 |
| TkA01G614480 | PF12708 | Pect-lyase_RHGA_epim | 188 | 296 | 7.6e-14 | 52.7 |
| TkA01G614480 | PF13229 | Beta_helix | 208 | 324 | 0.25 | 11.6 |
| TkA01G614480 | PF12708 | Pect-lyase_RHGA_epim | 278 | 328 | 7.6e-14 | 52.7 |
| TkA01G614480 | PF13229 | Beta_helix | 295 | 393 | 0.25 | 11.6 |
| TkA01G614480 | PF12708 | Pect-lyase_RHGA_epim | 350 | 392 | 7.6e-14 | 52.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.