TkA01G611790 | RubberDandelionOmics

Gene overview

TkA01G611790

Reference: TK1151 Chr: Chr01 Coordinates: 154246283-154248638 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1108 bp · TkA01G611790|TK1151|cDNA

AAAAAAGGTTATATGTCCAATTCCATAAGAGAGAGAGTGGAAAAGGTCATTGAATACAAATATACATGGACCCCGAATGCCAGAATTTAGAGAGGATCCAATCTCCAACCCATCTTTTGGATAAGCTTCCTAGTTTTCAATTTTCTACAATTTTAGTTTTTTACCATCAATCAAAAGATCCAATTTCGATCTAAAAGTTCCTAAAATCCTTTGATAAATGAATATATCTTCAATAAATCTCCCTCGGCCTAAAATATCTT...

CDS

Download CDS FASTA

570 bp · TkA01G611790|TK1151|CDS

ATGTCGATTTTAGCCCCAAATTCTCATCTTCTCTGCCGAGAAGTTCATCACAGAGATCAGCAGCAGCCACATCAACCAAATTGGAGCAACATTTGTTGTTCATATCCGATAAAAACCTGTGGGTTTGGTTTCGATGGAAGAAAAATGGATCAATGTAAGAAGACTGTGAAAAGGGATTGTAAAGCTGAATCTTTTTGGGACACATCAAGACCTGCGTTTGTGGAATTGGAACCTATCACCGACGCCGAACATTTGGATCT...

Protein

Download Protein FASTA

189 aa · TkA01G611790|TK1151|PROTEIN

MSILAPNSHLLCREVHHRDQQQPHQPNWSNICCSYPIKTCGFGFDGRKMDQCKKTVKRDCKAESFWDTSRPAFVELEPITDAEHLDLILDKAKQSSQPIVIDWMAAWCRKCIYLKPKLEKLAAEYDTKLTFYCVNVNNVPQALVKRGNISKMPTIQLWKDGEMKAEVIGGHKAWLVIEEVREMIQNFLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G611790`
TK1151 ID	TkA01G611790
OH-1004 ID	LXL04_000432
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.471 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G611790

Location Chr01:154246283-154248638 (-)

Description Similar to WCRKC1: Thioredoxin-like 3-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06690`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At5g04260`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release
`At1g31020`	Thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0774100`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045454 cell redox homeostasis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0015035 protein-disulfide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G04260

ath:AT5G06690

dosa:Os02g0774100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · TkA01G611790 · TK1151

Mitochondrion0.030

Rank 2 · TkA01G611790 · TK1151

Nucleus0.029

Rank 3 · TkA01G611790 · TK1151

Cytoplasm0.020

Rank 4 · TkA01G611790 · TK1151

Cell membrane0.011

Rank 5 · TkA01G611790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12269CpG_bind_C11-94 aa

PF17010DUF509277-99 aa

PF13098Thioredoxin_288-169 aa

PF13899Thioredoxin_789-117 aa

PF00085Thioredoxin93-173 aa

PF20207PedC-like108-184 aa

PF13743Thioredoxin_5108-148 aa

PF12269CpG_bind_C119-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G611790	`PF12269`	CpG_bind_C	11	94	0.0078	16.7
TkA01G611790	`PF17010`	DUF5092	77	99	0.24	12.1
TkA01G611790	`PF13098`	Thioredoxin_2	88	169	9.6e-05	23.4
TkA01G611790	`PF13899`	Thioredoxin_7	89	117	0.0037	18.1
TkA01G611790	`PF00085`	Thioredoxin	93	173	5.1e-16	59.3
TkA01G611790	`PF20207`	PedC-like	108	184	0.0042	17.8
TkA01G611790	`PF13743`	Thioredoxin_5	108	148	0.059	13.9
TkA01G611790	`PF12269`	CpG_bind_C	119	135	0.0078	16.7
TkA01G611790	`PF17010`	DUF5092	127	185	0.24	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG36`	Arabidopsis thaliana	sp\|Q9FG36\|TRL31_ARATH Thioredoxin-like 3-1, chloroplastic	52.600%	Swiss-Prot	High
`Q8VZT6`	Arabidopsis thaliana	sp\|Q8VZT6\|TRL32_ARATH Thioredoxin-like 3-2, chloroplastic	61.200%	Swiss-Prot	Medium
`Q93VQ9`	Arabidopsis thaliana	sp\|Q93VQ9\|TRXO2_ARATH Thioredoxin O2, mitochondrial	34.600%	Swiss-Prot	Medium
`Q6Z7L3`	Oryza sativa subsp. japonica	sp\|Q6Z7L3\|TRL31_ORYSJ Thioredoxin-like 3-1, chloroplastic	66.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card