RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G605070
Reference: TK1151 Chr: Chr01 Coordinates: 152468121-152470337 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1320 bp · TkA01G605070|TK1151|cDNA

GGATGACAAATGCTATTGCCTAGTCCTACTTTGATACGAGGATAGTGCGAGTTACAGTTCCCGACGAATGGCGGAGTCCGTCACTGACGGCGATGATTACGCCCTCCAGCGTCAACTAGCTCTTGTCGACGTTGTAACGCCCATTTCACATTCCAATTCTTCTGCGATCACTCCTTTCTCCTCACCGTTTTCCCTTCCTGACGGCTGGTTCGTCCACCAGGTCCCCCGCTCCGATGGCTCTCGCTTCGACAAGTATTACA...

CDS

Download CDS FASTA

1071 bp · TkA01G605070|TK1151|CDS

ATGGCGGAGTCCGTCACTGACGGCGATGATTACGCCCTCCAGCGTCAACTAGCTCTTGTCGACGTTGTAACGCCCATTTCACATTCCAATTCTTCTGCGATCACTCCTTTCTCCTCACCGTTTTCCCTTCCTGACGGCTGGTTCGTCCACCAGGTCCCCCGCTCCGATGGCTCTCGCTTCGACAAGTATTACATTGAGTCAGATACAGGGCGTAAGTTTCGATCTAGAAGAGAGGTTAATAGATACTTGAATGTTGAAGA...

Protein

Download Protein FASTA

356 aa · TkA01G605070|TK1151|PROTEIN

MAESVTDGDDYALQRQLALVDVVTPISHSNSSAITPFSSPFSLPDGWFVHQVPRSDGSRFDKYYIESDTGRKFRSRREVNRYLNVEEFKAARSRPLRLTYRRKNKMDLKMITSGSNYYHDSQSGRKFRSLKNVQRQLTPTKSRAKRLKYLQNHLQTCNSRKKIVSSGKMLGFEEDKNNKYQLVNVTPKSSQSTSPGPFTLPDGWIIEEVPRKNGDHIDRYYYEPGTGQKFRSLIAVQKHLSELDENAPLSLVLEELRENN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G605070
TK1151 IDTkA01G605070
OH-1004 IDLXL04_000523
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G605070
LocationChr01:152468121-152470337 (+)
DescriptionSimilar to MBD7: Methyl-CpG-binding domain-containing protein 7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g59800 Transcriptional regulator that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides.
Characterization of Arabidopsis thaliana methyl-CpG-binding domain (MBD) proteins.2003 · DOI: 10.1046/j.1365-313x.2003.01756.x
The three methyl-CpG-binding domains of AtMBD7 control its subnuclear localization and mobility.2008 · DOI: 10.1074/jbc.m706221200
Methyl-CpG-binding domain protein MBD7 is required for active DNA demethylation in Arabidopsis.2015 · DOI: 10.1104/pp.114.252106
The methyl-CpG-binding protein MBD7 facilitates active DNA demethylation to limit DNA hyper-methylation and transcriptional gene silencing.2015 · DOI: 10.1016/j.molcel.2015.01.009
At5g59380 Transcriptional regulator that binds CpG, CpNpN and CpNpG (N is A, T, or C) islands in promoters regardless the DNA methylation status.
Characterization of Arabidopsis thaliana methyl-CpG-binding domain (MBD) proteins.2003 · DOI: 10.1046/j.1365-313x.2003.01756.x
Arabidopsis MBD proteins show different binding specificities and nuclear localization.2003 · DOI: 10.1023/b:plan.0000019118.56822.a9
Multimegabase silencing in nucleolar dominance involves siRNA-directed DNA methylation and specific methylcytosine-binding proteins.2008 · DOI: 10.1016/j.molcel.2008.11.009
AtMBD6, a methyl CpG binding domain protein, maintains gene silencing in Arabidopsis by interacting with RNA binding proteins.2017 · DOI: 10.1007/s12038-016-9658-1
At3g46580 Transcriptional regulator that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides.
Characterization of Arabidopsis thaliana methyl-CpG-binding domain (MBD) proteins.2003 · DOI: 10.1046/j.1365-313x.2003.01756.x
Methylated DNA-binding proteins from Arabidopsis.2003 · DOI: 10.1104/pp.103.026708
Arabidopsis MBD proteins show different binding specificities and nuclear localization.2003 · DOI: 10.1023/b:plan.0000019118.56822.a9

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000523 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process
GO:0000792 heterochromatin Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005694 chromosome Cellular Component
GO:0005731 nucleolus organizer region Cellular Component
GO:0009536 plastid Cellular Component
GO:0010369 chromocenter Cellular Component
GO:0010370 perinucleolar chromocenter Cellular Component
GO:0008327 methyl-CpG binding Molecular Function
GO:0019899 enzyme binding Molecular Function
KEGG gene cross-reference
ath:AT3G46580
ath:AT5G59380
ath:AT5G59800
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964
Rank 1 · TkA01G605070 · TK1151
Cytoplasm0.071
Rank 2 · TkA01G605070 · TK1151
Cell membrane0.027
Rank 3 · TkA01G605070 · TK1151
Endoplasmic reticulum0.018
Rank 4 · TkA01G605070 · TK1151
Plastid0.014
Rank 5 · TkA01G605070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30893FNDC3_N35-57 aa
PF26919ABC-like_C41-59 aa
PF01429MBD42-87 aa
PF16761Clr2_transil42-79 aa
PF22970DUF702846-83 aa
PF16761Clr2_transil112-133 aa
PF22970DUF7028115-136 aa
PF01429MBD122-145 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G605070PF30893FNDC3_N35570.3211.8
TkA01G605070PF26919ABC-like_C41590.1213.0
TkA01G605070PF01429MBD42876.4e-1761.7
TkA01G605070PF16761Clr2_transil42791.9e-0629.3
TkA01G605070PF22970DUF702846833.5e-0524.4
TkA01G605070PF16761Clr2_transil1121331.9e-0629.3
TkA01G605070PF22970DUF70281151363.5e-0524.4
TkA01G605070PF01429MBD1221456.4e-1761.7
TkA01G605070PF30893FNDC3_N1892140.3211.8
TkA01G605070PF01429MBD1982426.4e-1761.7
TkA01G605070PF26919ABC-like_C1982150.1213.0
TkA01G605070PF16761Clr2_transil2002431.9e-0629.3
TkA01G605070PF22970DUF70282032423.5e-0524.4
TkA01G605070PF22970DUF70282662913.5e-0524.4
TkA01G605070PF01429MBD2812936.4e-1761.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FJF4Arabidopsis thalianasp|Q9FJF4|MBD7_ARATH Methyl-CpG-binding domain-containing protein 729.700%Swiss-ProtLow
Q9LTJ1Arabidopsis thalianasp|Q9LTJ1|MBD6_ARATH Methyl-CpG-binding domain-containing protein 628.700%Swiss-ProtLow
Q9SNC0Arabidopsis thalianasp|Q9SNC0|MBD5_ARATH Methyl-CpG-binding domain-containing protein 527.300%Swiss-ProtLow

JBrowse

View in Genome Browser